BLASTX nr result
ID: Mentha29_contig00017940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00017940 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513815.1| PREDICTED: uncharacterized protein LOC101491... 59 7e-07 >ref|XP_004513815.1| PREDICTED: uncharacterized protein LOC101491836 [Cicer arietinum] Length = 169 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/91 (34%), Positives = 51/91 (56%) Frame = -2 Query: 275 IEGIPYRTIPKPRAEYTPYDFKVDNLDHLARNVIQSTVFDAHLMRIMKYKTAKEM*DTLA 96 I G +IPKPR++ + D K D + +A+N+I S + R+ KTAK+M DTL Sbjct: 41 IAGTGDSSIPKPRSDLSEDDKKKDGYNVMAKNIITSALSADEFFRVSNCKTAKDMWDTLQ 100 Query: 95 LL*QGTEKINENKLSVLMRVFEALSMKNNET 3 +GT + +++ LM +E +MK +E+ Sbjct: 101 QTHEGTTDVKRARINTLMHEYEIFNMKKDES 131