BLASTX nr result
ID: Mentha29_contig00017567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00017567 (925 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD31239.1| NADH-plastoquinone oxidoreductase subunit K prote... 45 1e-06 ref|YP_008963484.1| NADH-plastoquinone oxidoreductase subunit K ... 45 4e-06 >gb|ADD31239.1| NADH-plastoquinone oxidoreductase subunit K protein [Ehretia acuminata] Length = 284 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = -3 Query: 182 NGRAYPNCGSVYAWRKGCIGTVLAPNCSDNKRKKEKR 72 N RAY NC KG IG VLAP CSDNK+KK K+ Sbjct: 18 NFRAYLNCWFSLCMAKGGIGMVLAPECSDNKKKKGKK 54 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -1 Query: 91 KGKRKKD*KAMSSIEFPLLNRTTKISVISS 2 KGK+K + M+SIEFPLL+RTT SVIS+ Sbjct: 51 KGKKKIE-TVMNSIEFPLLDRTTPNSVIST 79 >ref|YP_008963484.1| NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Penthorum chinense] gi|403226785|gb|AFR25664.1| NADH-plastoquinone oxidoreductase subunit K (chloroplast) [Penthorum chinense] Length = 285 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 6/49 (12%) Frame = -3 Query: 182 NGRAYPNCGSVYAWRKGCIGTVLAPNCSDNKRKK------EKRLKSYEF 54 N RAYPNC KG IG VLAP SDNK+KK EK + S EF Sbjct: 18 NFRAYPNCWFSLCMAKGGIGMVLAPEYSDNKKKKVTKNNIEKVMNSIEF 66 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -1 Query: 67 KAMSSIEFPLLNRTTKISVISS 2 K M+SIEFPLL+RTT SVIS+ Sbjct: 59 KVMNSIEFPLLDRTTPNSVIST 80