BLASTX nr result
ID: Mentha29_contig00017173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00017173 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q42716.1|C71A8_MENPI RecName: Full=Cytochrome P450 71A8 gi|49... 85 1e-14 >sp|Q42716.1|C71A8_MENPI RecName: Full=Cytochrome P450 71A8 gi|493475|emb|CAA83941.1| cytochrome P-450 oxidase [Mentha x piperita] Length = 502 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -3 Query: 238 NLMQKFDWELPHECRELDMSERPGVAIRRVVPLLAIGTKL 119 NLMQKFDWELPHECRELDMSERPGVAIRRV+PLLAIGTK+ Sbjct: 463 NLMQKFDWELPHECRELDMSERPGVAIRRVIPLLAIGTKM 502