BLASTX nr result
ID: Mentha29_contig00017073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00017073 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320049.1| hypothetical protein POPTR_0014s06250g [Popu... 58 1e-06 >ref|XP_002320049.1| hypothetical protein POPTR_0014s06250g [Populus trichocarpa] gi|222860822|gb|EEE98364.1| hypothetical protein POPTR_0014s06250g [Populus trichocarpa] Length = 298 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/63 (42%), Positives = 33/63 (52%) Frame = +1 Query: 1 AAAAADVFLAQCYVRYWEAGYYDXXXXXXXQDDXXXXXXXXXXXXXXXXXXXXFLSFCRK 180 +AAAADV+L QCY RYW +GYYD +DD FLSFCR+ Sbjct: 226 SAAAADVYLGQCYARYWASGYYDRSSDSSSEDDVGKTVAIIVGVLAGLSILIVFLSFCRR 285 Query: 181 ALG 189 A+G Sbjct: 286 AMG 288