BLASTX nr result
ID: Mentha29_contig00016520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00016520 (189 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46130.1| hypothetical protein MIMGU_mgv1a012257mg [Mimulus... 60 4e-07 >gb|EYU46130.1| hypothetical protein MIMGU_mgv1a012257mg [Mimulus guttatus] Length = 256 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 66 AAAANTTTFEPSSDLIQEDDCTTLLLYLPGFTKEQLRLQLT 188 AA T FEPS D ++E++C TLL+YLPGFTKEQLR+QLT Sbjct: 8 AATHMTNNFEPSFDWVREEECDTLLIYLPGFTKEQLRVQLT 48