BLASTX nr result
ID: Mentha29_contig00015569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00015569 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43654.1| hypothetical protein MIMGU_mgv1a014274mg [Mimulus... 61 2e-07 ref|XP_006365059.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 60 3e-07 ref|XP_002534450.1| Thioredoxin I, putative [Ricinus communis] g... 59 5e-07 emb|CBI27208.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vi... 59 7e-07 emb|CAN74552.1| hypothetical protein VITISV_019041 [Vitis vinifera] 59 7e-07 ref|XP_004233258.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 59 9e-07 ref|XP_004233257.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 59 9e-07 ref|XP_004233256.1| PREDICTED: thioredoxin O1, mitochondrial-lik... 59 9e-07 gb|EPS60692.1| hypothetical protein M569_14112 [Genlisea aurea] 57 3e-06 >gb|EYU43654.1| hypothetical protein MIMGU_mgv1a014274mg [Mimulus guttatus] Length = 195 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHFFQNGKKA EV+GADVE +K+TMETLYK Sbjct: 164 PTLHFFQNGKKASEVVGADVELVKDTMETLYK 195 >ref|XP_006365059.1| PREDICTED: thioredoxin O1, mitochondrial-like [Solanum tuberosum] Length = 194 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHF+QNGKK EVIGADV+RLKETME LYK Sbjct: 163 PTLHFYQNGKKTSEVIGADVQRLKETMEELYK 194 >ref|XP_002534450.1| Thioredoxin I, putative [Ricinus communis] gi|223525268|gb|EEF27933.1| Thioredoxin I, putative [Ricinus communis] Length = 206 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLY 341 PTLHFFQNGKKA E++GADVER+K+TME LY Sbjct: 173 PTLHFFQNGKKAAEIVGADVERIKDTMEELY 203 >emb|CBI27208.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHFFQNGKKA E+IGADV RLK+TM+ LYK Sbjct: 175 PTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 206 >ref|XP_002275152.1| PREDICTED: thioredoxin O1, mitochondrial [Vitis vinifera] gi|359473079|ref|XP_003631244.1| PREDICTED: thioredoxin O1, mitochondrial-like [Vitis vinifera] gi|297738008|emb|CBI27209.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHFFQNGKKA E+IGADV RLK+TM+ LYK Sbjct: 153 PTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 184 >emb|CAN74552.1| hypothetical protein VITISV_019041 [Vitis vinifera] Length = 152 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHFFQNGKKA E+IGADV RLK+TM+ LYK Sbjct: 121 PTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 152 >ref|XP_004233258.1| PREDICTED: thioredoxin O1, mitochondrial-like isoform 3 [Solanum lycopersicum] Length = 172 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHFFQNGKK EVIGADV+ LKETME LYK Sbjct: 141 PTLHFFQNGKKTSEVIGADVQLLKETMEELYK 172 >ref|XP_004233257.1| PREDICTED: thioredoxin O1, mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 189 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHFFQNGKK EVIGADV+ LKETME LYK Sbjct: 158 PTLHFFQNGKKTSEVIGADVQLLKETMEELYK 189 >ref|XP_004233256.1| PREDICTED: thioredoxin O1, mitochondrial-like isoform 1 [Solanum lycopersicum] Length = 194 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTLHFFQNGKK EVIGADV+ LKETME LYK Sbjct: 163 PTLHFFQNGKKTSEVIGADVQLLKETMEELYK 194 >gb|EPS60692.1| hypothetical protein M569_14112 [Genlisea aurea] Length = 177 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 433 PTLHFFQNGKKAGEVIGADVERLKETMETLYK 338 PTL FF NGKKA EV+GADV+R+KETME+LYK Sbjct: 146 PTLQFFHNGKKASEVVGADVQRVKETMESLYK 177