BLASTX nr result
ID: Mentha29_contig00014902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00014902 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana taba... 59 5e-07 gb|EYU24148.1| hypothetical protein MIMGU_mgv1a005983mg [Mimulus... 58 1e-06 ref|XP_006352984.1| PREDICTED: protection of telomeres protein 1... 55 8e-06 ref|NP_001275249.1| protection of telomeres 1 protein [Solanum t... 55 8e-06 >gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana tabacum] Length = 466 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = -1 Query: 238 KLEDETTNXXXXXXXXXXXSREILCTFLPVGMVLRMTVDQDNEKLRIELLKTNRWVVL 65 KLE+E N R+ILCT P+G VLR+T+D+ NEKL I LLK+NRWV L Sbjct: 205 KLEEELENPLPLQSVNSPLPRDILCTLPPLGTVLRVTIDRCNEKLGINLLKSNRWVKL 262 >gb|EYU24148.1| hypothetical protein MIMGU_mgv1a005983mg [Mimulus guttatus] Length = 462 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/56 (53%), Positives = 34/56 (60%) Frame = -1 Query: 238 KLEDETTNXXXXXXXXXXXSREILCTFLPVGMVLRMTVDQDNEKLRIELLKTNRWV 71 KLEDE N R+ILCTF VG VLR+ VDQ NE L I+ LKTN+WV Sbjct: 201 KLEDEMENPLPLDLDPSPLPRDILCTFPAVGTVLRIIVDQGNESLGIKFLKTNKWV 256 >ref|XP_006352984.1| PREDICTED: protection of telomeres protein 1b isoform X2 [Solanum tuberosum] Length = 406 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = -1 Query: 238 KLEDETTNXXXXXXXXXXXSREILCTFLPVGMVLRMTVDQDNEKLRIELLKTNRWVVL 65 KLE+E N R++LCT P+G VLR+ VD+ NEKL I LK+NRWV L Sbjct: 205 KLEEEMENPLPLQPVDFILQRDVLCTLPPLGTVLRVIVDRCNEKLGINFLKSNRWVKL 262 >ref|NP_001275249.1| protection of telomeres 1 protein [Solanum tuberosum] gi|213495898|gb|ACJ49169.1| protection of telomeres 1 protein [Solanum tuberosum] Length = 466 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = -1 Query: 238 KLEDETTNXXXXXXXXXXXSREILCTFLPVGMVLRMTVDQDNEKLRIELLKTNRWVVL 65 KLE+E N R++LCT P+G VLR+ VD+ NEKL I LK+NRWV L Sbjct: 205 KLEEEMENPLPLQPVDFILQRDVLCTLPPLGTVLRVIVDRCNEKLGINFLKSNRWVKL 262