BLASTX nr result
ID: Mentha29_contig00014635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00014635 (561 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447226.1| hypothetical protein CICLE_v10017238mg [Citr... 55 9e-06 >ref|XP_006447226.1| hypothetical protein CICLE_v10017238mg [Citrus clementina] gi|568831316|ref|XP_006469916.1| PREDICTED: uncharacterized protein LOC102614119 isoform X3 [Citrus sinensis] gi|557549837|gb|ESR60466.1| hypothetical protein CICLE_v10017238mg [Citrus clementina] Length = 97 Score = 55.5 bits (132), Expect = 9e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 3 CVVSLQPYHTATASALMMSMLTVSRCGFGWLPGA 104 CV S+ PYHTATASAL S+L++S+CG+GWLP A Sbjct: 59 CVESMLPYHTATASALSTSLLSISQCGYGWLPEA 92