BLASTX nr result
ID: Mentha29_contig00014601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00014601 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41826.1| hypothetical protein MIMGU_mgv1a016676mg [Mimulus... 74 2e-11 gb|EYU26636.1| hypothetical protein MIMGU_mgv1a016658mg [Mimulus... 74 2e-11 gb|EXB75174.1| 60S ribosomal protein L35a-3 [Morus notabilis] 74 2e-11 gb|AAK25760.1|AF334840_1 ribosomal protein L33 [Castanea sativa] 74 2e-11 gb|EYU41823.1| hypothetical protein MIMGU_mgv1a015450mg [Mimulus... 73 4e-11 ref|XP_007207502.1| hypothetical protein PRUPE_ppa013629mg [Prun... 73 4e-11 gb|ACJ02349.1| 60S ribosomal protein L35a [Vernicia fordii] 73 5e-11 ref|XP_002316240.1| 60S ribosomal protein L35a [Populus trichoca... 73 5e-11 ref|XP_002311198.1| ribosomal protein L33 [Populus trichocarpa] ... 73 5e-11 ref|XP_002277272.1| PREDICTED: 60S ribosomal protein L35a-1-like... 73 5e-11 ref|XP_004512402.1| PREDICTED: 60S ribosomal protein L35a-1-like... 72 6e-11 ref|XP_004494288.1| PREDICTED: 60S ribosomal protein L35a-1-like... 72 6e-11 ref|XP_004490943.1| PREDICTED: 60S ribosomal protein L35a-1-like... 72 6e-11 ref|XP_003616553.1| Maturase [Medicago truncatula] gi|355517888|... 72 6e-11 ref|NP_001241369.1| uncharacterized protein LOC100800463 [Glycin... 72 6e-11 gb|ACJ84078.1| unknown [Medicago truncatula] 72 6e-11 gb|ACJ83951.1| unknown [Medicago truncatula] gi|217075632|gb|ACJ... 72 6e-11 ref|XP_006435563.1| hypothetical protein CICLE_v10033116mg [Citr... 72 8e-11 ref|XP_006584481.1| PREDICTED: uncharacterized protein LOC100305... 72 1e-10 ref|XP_006368064.1| PREDICTED: 60S ribosomal protein L35a-3-like... 72 1e-10 >gb|EYU41826.1| hypothetical protein MIMGU_mgv1a016676mg [Mimulus guttatus] Length = 112 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >gb|EYU26636.1| hypothetical protein MIMGU_mgv1a016658mg [Mimulus guttatus] gi|604313306|gb|EYU26637.1| hypothetical protein MIMGU_mgv1a016658mg [Mimulus guttatus] Length = 112 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >gb|EXB75174.1| 60S ribosomal protein L35a-3 [Morus notabilis] Length = 112 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >gb|AAK25760.1|AF334840_1 ribosomal protein L33 [Castanea sativa] Length = 112 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >gb|EYU41823.1| hypothetical protein MIMGU_mgv1a015450mg [Mimulus guttatus] Length = 157 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK++RPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 119 GKVSRPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 153 >ref|XP_007207502.1| hypothetical protein PRUPE_ppa013629mg [Prunus persica] gi|462403144|gb|EMJ08701.1| hypothetical protein PRUPE_ppa013629mg [Prunus persica] Length = 112 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK++RPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVSRPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >gb|ACJ02349.1| 60S ribosomal protein L35a [Vernicia fordii] Length = 112 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_002316240.1| 60S ribosomal protein L35a [Populus trichocarpa] gi|118482276|gb|ABK93065.1| unknown [Populus trichocarpa] gi|222865280|gb|EEF02411.1| 60S ribosomal protein L35a [Populus trichocarpa] Length = 112 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_002311198.1| ribosomal protein L33 [Populus trichocarpa] gi|566182656|ref|XP_006379617.1| hypothetical protein POPTR_0008s06370g [Populus trichocarpa] gi|118483364|gb|ABK93583.1| unknown [Populus trichocarpa] gi|118484807|gb|ABK94271.1| unknown [Populus trichocarpa] gi|222851018|gb|EEE88565.1| ribosomal protein L33 [Populus trichocarpa] gi|550332542|gb|ERP57414.1| hypothetical protein POPTR_0008s06370g [Populus trichocarpa] Length = 112 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_002277272.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform 1 [Vitis vinifera] gi|225449234|ref|XP_002280039.1| PREDICTED: 60S ribosomal protein L35a-1 [Vitis vinifera] gi|359481695|ref|XP_003632660.1| PREDICTED: 60S ribosomal protein L35a-1-like isoform 2 [Vitis vinifera] gi|147823354|emb|CAN64195.1| hypothetical protein VITISV_014336 [Vitis vinifera] gi|296086107|emb|CBI31548.3| unnamed protein product [Vitis vinifera] gi|297740261|emb|CBI30443.3| unnamed protein product [Vitis vinifera] Length = 112 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSGVVRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_004512402.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum] Length = 112 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSG+VRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_004494288.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum] Length = 112 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSG+VRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_004490943.1| PREDICTED: 60S ribosomal protein L35a-1-like [Cicer arietinum] Length = 112 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSG+VRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_003616553.1| Maturase [Medicago truncatula] gi|355517888|gb|AES99511.1| Maturase [Medicago truncatula] Length = 657 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSG+VRAKFKSNLPPKSMGARVRVFMY Sbjct: 99 GKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMY 133 >ref|NP_001241369.1| uncharacterized protein LOC100800463 [Glycine max] gi|255637727|gb|ACU19186.1| unknown [Glycine max] Length = 112 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSG+VRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMY 108 >gb|ACJ84078.1| unknown [Medicago truncatula] Length = 112 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSG+VRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMY 108 >gb|ACJ83951.1| unknown [Medicago truncatula] gi|217075632|gb|ACJ86176.1| unknown [Medicago truncatula] gi|388498662|gb|AFK37397.1| unknown [Medicago truncatula] Length = 112 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSG+VRAKFKSNLPPKSMGARVRVFMY Sbjct: 74 GKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMY 108 >ref|XP_006435563.1| hypothetical protein CICLE_v10033116mg [Citrus clementina] gi|568866222|ref|XP_006486456.1| PREDICTED: 60S ribosomal protein L35a-1-like [Citrus sinensis] gi|557537759|gb|ESR48803.1| hypothetical protein CICLE_v10033116mg [Citrus clementina] Length = 112 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ARPHGNSGVVRAKFKSNLPPKSMG RVRVFMY Sbjct: 74 GKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMY 108 >ref|XP_006584481.1| PREDICTED: uncharacterized protein LOC100305958 isoform X1 [Glycine max] Length = 125 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSGVVRAKFKSNLPP+SMGARVRVFMY Sbjct: 87 GKVTRPHGNSGVVRAKFKSNLPPRSMGARVRVFMY 121 >ref|XP_006368064.1| PREDICTED: 60S ribosomal protein L35a-3-like [Solanum tuberosum] Length = 112 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 296 GKIARPHGNSGVVRAKFKSNLPPKSMGARVRVFMY 192 GK+ RPHGNSGVVRAKFKSNLPPKSMGA+VRVFMY Sbjct: 74 GKVCRPHGNSGVVRAKFKSNLPPKSMGAKVRVFMY 108