BLASTX nr result
ID: Mentha29_contig00014066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00014066 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235112.1| PREDICTED: glucan endo-1,3-beta-glucosidase-... 57 2e-06 ref|XP_003561280.1| PREDICTED: glucan endo-1,3-beta-glucosidase-... 56 6e-06 ref|XP_002271991.2| PREDICTED: glucan endo-1,3-beta-glucosidase ... 55 8e-06 ref|XP_004241225.1| PREDICTED: glucan endo-1,3-beta-glucosidase-... 47 8e-06 >ref|XP_004235112.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum] Length = 407 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +2 Query: 2 GPICERNFGLFRPDFTPVYDVGILKRPLAANAAEMVIRRGTCYLVMILL 148 GP CERNFGLF+PD TPVYD+GIL P ANAA T L+++L+ Sbjct: 355 GPTCERNFGLFKPDMTPVYDIGIL-HPRVANAAANTDHSRTNLLLLLLV 402 >ref|XP_003561280.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brachypodium distachyon] Length = 475 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 GPICERNFGLFRPDFTPVYDVGILKRPLAANA 97 GP+ ERNFGLF+PDFTP+YDVGI+K P+ A A Sbjct: 329 GPVAERNFGLFQPDFTPMYDVGIMKGPVTAPA 360 >ref|XP_002271991.2| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Vitis vinifera] Length = 874 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 2 GPICERNFGLFRPDFTPVYDVGILKRPLAANAA 100 GP+CERNFGLF+PD TPVYD+GI+ RP A+AA Sbjct: 318 GPLCERNFGLFQPDLTPVYDIGIM-RPTVADAA 349 >ref|XP_004241225.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum] Length = 449 Score = 47.0 bits (110), Expect(2) = 8e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +2 Query: 14 ERNFGLFRPDFTPVYDVGILKRPLAANAAEM 106 ERNFGLFRPDF+PVYDVGIL+ A + M Sbjct: 325 ERNFGLFRPDFSPVYDVGILRNTQALSPPAM 355 Score = 28.1 bits (61), Expect(2) = 8e-06 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 222 NLDCVCGLGFWRAARFKREGPCFDP 296 NLD VC G K GPCF+P Sbjct: 378 NLDFVCSSGIVDCQPIKDGGPCFEP 402