BLASTX nr result
ID: Mentha29_contig00013948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00013948 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233436.1| PREDICTED: aspartic proteinase PCS1-like [So... 100 2e-19 ref|XP_006360220.1| PREDICTED: aspartic proteinase PCS1-like [So... 98 1e-18 emb|CBI31649.3| unnamed protein product [Vitis vinifera] 94 3e-17 ref|XP_002283126.1| PREDICTED: aspartic proteinase nepenthesin-2... 94 3e-17 emb|CAN70318.1| hypothetical protein VITISV_016757 [Vitis vinifera] 94 3e-17 ref|XP_007140512.1| hypothetical protein PHAVU_008G118900g [Phas... 92 6e-17 ref|XP_007206819.1| hypothetical protein PRUPE_ppa025962mg, part... 92 7e-17 ref|XP_004514393.1| PREDICTED: aspartic proteinase PCS1-like [Ci... 91 2e-16 ref|XP_006381198.1| hypothetical protein POPTR_0006s08790g [Popu... 91 2e-16 ref|XP_006387010.1| hypothetical protein POPTR_2222s00200g [Popu... 91 2e-16 gb|EYU19926.1| hypothetical protein MIMGU_mgv1a026057mg, partial... 90 4e-16 ref|XP_004307483.1| PREDICTED: aspartic proteinase PCS1-like [Fr... 90 4e-16 ref|XP_003530215.1| PREDICTED: aspartic proteinase PCS1-like [Gl... 90 4e-16 ref|XP_002271077.2| PREDICTED: aspartic proteinase nepenthesin-1... 89 6e-16 emb|CBI30526.3| unnamed protein product [Vitis vinifera] 89 6e-16 ref|XP_002458751.1| hypothetical protein SORBIDRAFT_03g039590 [S... 89 6e-16 ref|XP_006480872.1| PREDICTED: aspartic proteinase PCS1-like [Ci... 89 8e-16 ref|XP_006429126.1| hypothetical protein CICLE_v10011788mg [Citr... 89 8e-16 ref|XP_004970553.1| PREDICTED: aspartic proteinase PCS1-like [Se... 89 8e-16 ref|XP_002531560.1| Aspartic proteinase nepenthesin-2 precursor,... 89 8e-16 >ref|XP_004233436.1| PREDICTED: aspartic proteinase PCS1-like [Solanum lycopersicum] Length = 429 Score = 100 bits (250), Expect = 2e-19 Identities = 44/63 (69%), Positives = 55/63 (87%) Frame = -2 Query: 189 AKQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPL 10 AK+ PS S +PPNK++FHHNVSLTVS+S+G+PPQ MVLDTGSELSW+HC+KTP+TPL Sbjct: 34 AKKTPSISASKPPNKVAFHHNVSLTVSLSIGSPPQQVVMVLDTGSELSWVHCKKTPTTPL 93 Query: 9 SFS 1 F+ Sbjct: 94 IFN 96 >ref|XP_006360220.1| PREDICTED: aspartic proteinase PCS1-like [Solanum tuberosum] Length = 429 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = -2 Query: 186 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLS 7 K+ S S P+PPN+++FHHNVSLTVS+S+G+PPQ MVLDTGSELSWLHC+KTP TPL Sbjct: 35 KKTASISSPKPPNRVAFHHNVSLTVSLSIGSPPQQVVMVLDTGSELSWLHCKKTPITPLI 94 Query: 6 FS 1 F+ Sbjct: 95 FN 96 >emb|CBI31649.3| unnamed protein product [Vitis vinifera] Length = 761 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPS 19 +PS S+PRP +KLSFHHNVSLTVS++VG+PPQ TMVLDTGSELSWLHC+K P+ Sbjct: 355 LPSGSVPRPSSKLSFHHNVSLTVSLTVGSPPQTVTMVLDTGSELSWLHCKKAPN 408 >ref|XP_002283126.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 436 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPS 19 +PS S+PRP +KLSFHHNVSLTVS++VG+PPQ TMVLDTGSELSWLHC+K P+ Sbjct: 43 LPSGSVPRPSSKLSFHHNVSLTVSLTVGSPPQTVTMVLDTGSELSWLHCKKAPN 96 >emb|CAN70318.1| hypothetical protein VITISV_016757 [Vitis vinifera] Length = 429 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPS 19 +PS S+PRP +KLSFHHNVSLTVS++VG+PPQ TMVLDTGSELSWLHC+K P+ Sbjct: 36 LPSGSVPRPSSKLSFHHNVSLTVSLTVGSPPQTVTMVLDTGSELSWLHCKKAPN 89 >ref|XP_007140512.1| hypothetical protein PHAVU_008G118900g [Phaseolus vulgaris] gi|561013645|gb|ESW12506.1| hypothetical protein PHAVU_008G118900g [Phaseolus vulgaris] Length = 440 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPL 10 IPS LPRPPNKL F+HNVSLT+S++VGTPPQ +MV+DTGSELSWLHC T + PL Sbjct: 43 IPSGYLPRPPNKLRFNHNVSLTISITVGTPPQNVSMVIDTGSELSWLHCNNTNTNPL 99 >ref|XP_007206819.1| hypothetical protein PRUPE_ppa025962mg, partial [Prunus persica] gi|462402461|gb|EMJ08018.1| hypothetical protein PRUPE_ppa025962mg, partial [Prunus persica] Length = 431 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = -2 Query: 186 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLS 7 +QIPS SLP+ PN+L FHHNV+LTVS++VGTPPQ +MV+DTGSELSWLHC KT + + Sbjct: 36 QQIPSGSLPKSPNRLPFHHNVTLTVSIAVGTPPQNVSMVIDTGSELSWLHCNKTRNFNTT 95 Query: 6 F 4 F Sbjct: 96 F 96 >ref|XP_004514393.1| PREDICTED: aspartic proteinase PCS1-like [Cicer arietinum] Length = 452 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/58 (70%), Positives = 47/58 (81%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLS 7 IPS LPRPPNKL FHHNVSLTVS++VGTPPQ T+V+DTGSELSWLHC + +S Sbjct: 49 IPSGYLPRPPNKLRFHHNVSLTVSITVGTPPQNVTLVIDTGSELSWLHCSNNTTNRVS 106 >ref|XP_006381198.1| hypothetical protein POPTR_0006s08790g [Populus trichocarpa] gi|550335806|gb|ERP58995.1| hypothetical protein POPTR_0006s08790g [Populus trichocarpa] Length = 305 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/59 (71%), Positives = 48/59 (81%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSF 4 IPS S+PR PNK FHHNVSL VS++VGTPPQ +MV+DTGSELSWLHC KT S P +F Sbjct: 55 IPSGSVPRSPNKPPFHHNVSLIVSLTVGTPPQNVSMVIDTGSELSWLHCNKTLSYPTTF 113 >ref|XP_006387010.1| hypothetical protein POPTR_2222s00200g [Populus trichocarpa] gi|550304072|gb|ERP45924.1| hypothetical protein POPTR_2222s00200g [Populus trichocarpa] Length = 416 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/59 (71%), Positives = 48/59 (81%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSF 4 IPS S+PR PNK FHHNVSL VS++VGTPPQ +MV+DTGSELSWLHC KT S P +F Sbjct: 23 IPSGSVPRSPNKPPFHHNVSLIVSLTVGTPPQNVSMVIDTGSELSWLHCNKTLSYPTTF 81 >gb|EYU19926.1| hypothetical protein MIMGU_mgv1a026057mg, partial [Mimulus guttatus] Length = 395 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/51 (76%), Positives = 48/51 (94%) Frame = -2 Query: 153 PNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSFS 1 PNKLSFHHNV+LTV+++VG+PPQ TMVLDTGSELSWL+C+KTP+TP SF+ Sbjct: 10 PNKLSFHHNVTLTVALAVGSPPQQVTMVLDTGSELSWLNCKKTPTTPSSFA 60 >ref|XP_004307483.1| PREDICTED: aspartic proteinase PCS1-like [Fragaria vesca subsp. vesca] Length = 430 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/53 (71%), Positives = 48/53 (90%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTP 22 + +++LP+P NKLSFHHNV+LT+S++VG PPQ TMVLDTGSELSWLHC+KTP Sbjct: 34 LKTQTLPKPSNKLSFHHNVTLTISLTVGLPPQNVTMVLDTGSELSWLHCKKTP 86 >ref|XP_003530215.1| PREDICTED: aspartic proteinase PCS1-like [Glycine max] Length = 442 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSF 4 IPS LPRPPNKL FHHNVSLT+S++VGTPPQ +MV+DTGSELSWLHC + + + Sbjct: 46 IPSGYLPRPPNKLRFHHNVSLTISITVGTPPQNMSMVIDTGSELSWLHCNTNTTATIPY 104 >ref|XP_002271077.2| PREDICTED: aspartic proteinase nepenthesin-1-like [Vitis vinifera] Length = 458 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/59 (69%), Positives = 47/59 (79%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSF 4 +PS S PR PNKL FHHNVSLTVS++VGTPPQ +MVLDTGSELSWL C KT + +F Sbjct: 65 VPSGSFPRSPNKLHFHHNVSLTVSLTVGTPPQNVSMVLDTGSELSWLRCNKTQTFQTTF 123 >emb|CBI30526.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/59 (69%), Positives = 47/59 (79%) Frame = -2 Query: 180 IPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPSTPLSF 4 +PS S PR PNKL FHHNVSLTVS++VGTPPQ +MVLDTGSELSWL C KT + +F Sbjct: 48 VPSGSFPRSPNKLHFHHNVSLTVSLTVGTPPQNVSMVLDTGSELSWLRCNKTQTFQTTF 106 >ref|XP_002458751.1| hypothetical protein SORBIDRAFT_03g039590 [Sorghum bicolor] gi|241930726|gb|EES03871.1| hypothetical protein SORBIDRAFT_03g039590 [Sorghum bicolor] Length = 444 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -2 Query: 189 AKQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHC 34 A+Q+P+ +LPRPP+KL FHHNVSLTVS++VGTPPQ TMVLDTGSELSWL C Sbjct: 40 ARQVPAGALPRPPSKLRFHHNVSLTVSLAVGTPPQNVTMVLDTGSELSWLLC 91 >ref|XP_006480872.1| PREDICTED: aspartic proteinase PCS1-like [Citrus sinensis] Length = 443 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = -2 Query: 186 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKT 25 ++IPS S PR PNKL FHHNVSL VS++VGTPPQ +MVLDTGSELSWLHC T Sbjct: 47 QEIPSGSFPRSPNKLPFHHNVSLAVSLTVGTPPQNVSMVLDTGSELSWLHCNNT 100 >ref|XP_006429126.1| hypothetical protein CICLE_v10011788mg [Citrus clementina] gi|557531183|gb|ESR42366.1| hypothetical protein CICLE_v10011788mg [Citrus clementina] Length = 428 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = -2 Query: 186 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKT 25 ++IPS S PR PNKL FHHNVSL VS++VGTPPQ +MVLDTGSELSWLHC T Sbjct: 47 QEIPSGSFPRSPNKLPFHHNVSLAVSLTVGTPPQNVSMVLDTGSELSWLHCNNT 100 >ref|XP_004970553.1| PREDICTED: aspartic proteinase PCS1-like [Setaria italica] Length = 441 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -2 Query: 189 AKQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHC 34 A+Q+P+ +LPRPP+KL FHHNVSLTVS++VGTPPQ TMVLDTGSELSWL C Sbjct: 40 ARQVPAWALPRPPSKLRFHHNVSLTVSLAVGTPPQNVTMVLDTGSELSWLLC 91 >ref|XP_002531560.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] gi|223528821|gb|EEF30826.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] Length = 407 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/57 (68%), Positives = 48/57 (84%) Frame = -2 Query: 186 KQIPSRSLPRPPNKLSFHHNVSLTVSVSVGTPPQLATMVLDTGSELSWLHCRKTPST 16 ++IPS S PR PNKL F HN+SLTVS++VGTPPQ +MV+DTGSELSWL+C KT +T Sbjct: 9 EEIPSNSFPRSPNKLPFRHNISLTVSLTVGTPPQNVSMVIDTGSELSWLYCNKTTTT 65