BLASTX nr result
ID: Mentha29_contig00013578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00013578 (530 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38506.1| hypothetical protein MIMGU_mgv1a022088mg [Mimulus... 89 5e-16 ref|XP_006398738.1| hypothetical protein EUTSA_v10015802mg [Eutr... 87 3e-15 ref|XP_007027208.1| Spo11/DNA topoisomerase VI, subunit A protei... 87 3e-15 ref|XP_006287809.1| hypothetical protein CARUB_v10001024mg [Caps... 87 3e-15 emb|CBI32617.3| unnamed protein product [Vitis vinifera] 87 3e-15 ref|XP_002274790.1| PREDICTED: DNA topoisomerase 6 subunit A-lik... 87 3e-15 ref|NP_195902.1| DNA topoisomerase 6 subunit A [Arabidopsis thal... 87 3e-15 ref|XP_006428908.1| hypothetical protein CICLE_v10011761mg [Citr... 86 4e-15 ref|XP_006367265.1| PREDICTED: DNA topoisomerase 6 subunit A-lik... 86 7e-15 ref|XP_004246706.1| PREDICTED: DNA topoisomerase 6 subunit A-lik... 86 7e-15 ref|XP_006381506.1| brassinosteroid insensitive 5 family protein... 85 1e-14 ref|XP_004142105.1| PREDICTED: DNA topoisomerase 6 subunit A-lik... 84 2e-14 ref|XP_002525197.1| meiotic recombination protein spo11, putativ... 84 2e-14 ref|XP_004497452.1| PREDICTED: DNA topoisomerase 6 subunit A-lik... 84 3e-14 ref|XP_007144519.1| hypothetical protein PHAVU_007G162700g [Phas... 83 3e-14 ref|XP_003542493.1| PREDICTED: DNA topoisomerase 6 subunit A-lik... 83 3e-14 ref|XP_003537243.1| PREDICTED: DNA topoisomerase 6 subunit A-lik... 83 3e-14 gb|EXB84821.1| DNA topoisomerase 6 subunit A [Morus notabilis] 83 5e-14 ref|XP_006828295.1| hypothetical protein AMTR_s00023p00230220 [A... 82 6e-14 gb|AFG51276.1| hypothetical protein CL1001Contig1_01, partial [P... 82 6e-14 >gb|EYU38506.1| hypothetical protein MIMGU_mgv1a022088mg [Mimulus guttatus] Length = 422 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVKSKQKAEIQAL G YLT+VYLPLKLQ+ DWL Sbjct: 373 FVKKNPGWVEELNLMVKSKQKAEIQALSSFGFQYLTEVYLPLKLQQQDWL 422 >ref|XP_006398738.1| hypothetical protein EUTSA_v10015802mg [Eutrema salsugineum] gi|557099828|gb|ESQ40191.1| hypothetical protein EUTSA_v10015802mg [Eutrema salsugineum] Length = 429 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 380 FVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 429 >ref|XP_007027208.1| Spo11/DNA topoisomerase VI, subunit A protein isoform 1 [Theobroma cacao] gi|590630213|ref|XP_007027209.1| Spo11/DNA topoisomerase VI, subunit A protein isoform 1 [Theobroma cacao] gi|508715813|gb|EOY07710.1| Spo11/DNA topoisomerase VI, subunit A protein isoform 1 [Theobroma cacao] gi|508715814|gb|EOY07711.1| Spo11/DNA topoisomerase VI, subunit A protein isoform 1 [Theobroma cacao] Length = 418 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 369 FVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 418 >ref|XP_006287809.1| hypothetical protein CARUB_v10001024mg [Capsella rubella] gi|482556515|gb|EOA20707.1| hypothetical protein CARUB_v10001024mg [Capsella rubella] Length = 427 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 378 FVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 427 >emb|CBI32617.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 414 FVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 463 >ref|XP_002274790.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Vitis vinifera] Length = 420 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 371 FVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 420 >ref|NP_195902.1| DNA topoisomerase 6 subunit A [Arabidopsis thaliana] gi|297806215|ref|XP_002870991.1| hypothetical protein ARALYDRAFT_487058 [Arabidopsis lyrata subsp. lyrata] gi|75335684|sp|Q9LZ03.1|TOP6A_ARATH RecName: Full=DNA topoisomerase 6 subunit A; Short=AtTOP6A; AltName: Full=Meiotic recombination protein SPO11-3; Short=AtSPO11-3; AltName: Full=Protein BRASSINOSTEROID INSENSITIVE 5; AltName: Full=Protein ROOT HAIRLESS 2 gi|15488539|gb|AAL01152.1|AF323679_1 putative topoisomerase VI subunit A [Arabidopsis thaliana] gi|7413557|emb|CAB86036.1| meiosis specific-like protein [Arabidopsis thaliana] gi|12331186|emb|CAC24689.1| topoisomerase 6 subunit A [Arabidopsis thaliana] gi|114213517|gb|ABI54341.1| At5g02820 [Arabidopsis thaliana] gi|297316828|gb|EFH47250.1| hypothetical protein ARALYDRAFT_487058 [Arabidopsis lyrata subsp. lyrata] gi|332003139|gb|AED90522.1| DNA topoisomerase 6 subunit A [Arabidopsis thaliana] Length = 427 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 378 FVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 427 >ref|XP_006428908.1| hypothetical protein CICLE_v10011761mg [Citrus clementina] gi|568853885|ref|XP_006480568.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Citrus sinensis] gi|557530965|gb|ESR42148.1| hypothetical protein CICLE_v10011761mg [Citrus clementina] Length = 435 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 386 FVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQKDWL 435 >ref|XP_006367265.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Solanum tuberosum] Length = 419 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNP WVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQE DWL Sbjct: 370 FVKKNPAWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQEQDWL 419 >ref|XP_004246706.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Solanum lycopersicum] Length = 419 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNP WVEELNLMVK+KQKAEIQAL G YL++VYLPLKLQE DWL Sbjct: 370 FVKKNPAWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQEQDWL 419 >ref|XP_006381506.1| brassinosteroid insensitive 5 family protein [Populus trichocarpa] gi|550336210|gb|ERP59303.1| brassinosteroid insensitive 5 family protein [Populus trichocarpa] Length = 423 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL+LMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 374 FVKKNPGWVEELSLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 423 >ref|XP_004142105.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Cucumis sativus] gi|449521501|ref|XP_004167768.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Cucumis sativus] Length = 420 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL+LMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 371 FVKKNPGWVEELSLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQKDWL 420 >ref|XP_002525197.1| meiotic recombination protein spo11, putative [Ricinus communis] gi|223535494|gb|EEF37163.1| meiotic recombination protein spo11, putative [Ricinus communis] Length = 421 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL LMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 372 FVKKNPGWVEELTLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 421 >ref|XP_004497452.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Cicer arietinum] Length = 417 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL LMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 368 FVKKNPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQQDWL 417 >ref|XP_007144519.1| hypothetical protein PHAVU_007G162700g [Phaseolus vulgaris] gi|561017709|gb|ESW16513.1| hypothetical protein PHAVU_007G162700g [Phaseolus vulgaris] Length = 417 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL LMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 368 FVKKNPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >ref|XP_003542493.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Glycine max] Length = 417 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL LMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 368 FVKKNPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 417 >ref|XP_003537243.1| PREDICTED: DNA topoisomerase 6 subunit A-like [Glycine max] Length = 419 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL LMVK+KQKAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 370 FVKKNPGWVEELTLMVKTKQKAEIQALSTFGFQYLSEVYLPLKLQQKDWL 419 >gb|EXB84821.1| DNA topoisomerase 6 subunit A [Morus notabilis] Length = 424 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL LMVK+K+KAEIQAL G YL++VYLPLKLQ+ DWL Sbjct: 375 FVKKNPGWVEELTLMVKTKKKAEIQALSSFGFQYLSEVYLPLKLQQQDWL 424 >ref|XP_006828295.1| hypothetical protein AMTR_s00023p00230220 [Amborella trichopoda] gi|548832942|gb|ERM95711.1| hypothetical protein AMTR_s00023p00230220 [Amborella trichopoda] Length = 424 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKKNPGWVEEL +MVKS+QKAEIQAL G YL++VYLPLK+Q+ DWL Sbjct: 375 FVKKNPGWVEELGIMVKSRQKAEIQALSSFGFQYLSEVYLPLKIQQKDWL 424 >gb|AFG51276.1| hypothetical protein CL1001Contig1_01, partial [Pinus taeda] Length = 75 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -2 Query: 529 FVKKNPGWVEELNLMVKSKQKAEIQALCGLGIWYLTKVYLPLKLQEMDWL 380 FVKK+PGWV+ELNLMVK+KQKAEIQAL G YL++VYLPLKLQ+ DW+ Sbjct: 26 FVKKSPGWVDELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQRDWI 75