BLASTX nr result
ID: Mentha29_contig00013294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00013294 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20066.1| hypothetical protein MIMGU_mgv1a000446mg [Mimulus... 75 1e-11 >gb|EYU20066.1| hypothetical protein MIMGU_mgv1a000446mg [Mimulus guttatus] Length = 1148 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 3/78 (3%) Frame = -3 Query: 226 DKNFANFKVPE---ETSKDIGEMVSKYFYMNGFQSSQKRKTFDFMEGESGGRKGPKLTRR 56 DK+ N+KV E + S DI +MVSKYFYMN SS K+KT D ++G + P+ +RR Sbjct: 259 DKSILNYKVVENDDQESGDIEQMVSKYFYMNNPPSSSKKKTSDLDFMDNGRKDDPRGSRR 318 Query: 55 KYHRVSSHSTNLKRDCFY 2 Y+R SHS + KRDCFY Sbjct: 319 NYNRTGSHSGSSKRDCFY 336