BLASTX nr result
ID: Mentha29_contig00013070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00013070 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19635.1| hypothetical protein MIMGU_mgv1a003204mg [Mimulus... 67 9e-19 >gb|EYU19635.1| hypothetical protein MIMGU_mgv1a003204mg [Mimulus guttatus] Length = 600 Score = 67.4 bits (163), Expect(2) = 9e-19 Identities = 33/64 (51%), Positives = 46/64 (71%) Frame = -3 Query: 275 IKIMYSNSGAGYTLFNCSGALEDTKWALGPISCLSRGNYRVYAYRSSDSVTDLSLSRCVK 96 + + Y +SG YTLFNCS L D++ A P++CL+ G +RVYA+ SS SVTD +S C+K Sbjct: 131 VDLRYDSSG--YTLFNCS-KLPDSRAASYPVTCLNHGGFRVYAFGSSYSVTDFPMSTCLK 187 Query: 95 MYNV 84 MYN+ Sbjct: 188 MYNI 191 Score = 51.6 bits (122), Expect(2) = 9e-19 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -1 Query: 88 MSDVSEVLFAGPSEYSVDDTYLHWPQPVC 2 +SD+S VLF GP+E+SVDDTYL WP+P C Sbjct: 191 ISDISRVLFDGPAEFSVDDTYLRWPEPSC 219