BLASTX nr result
ID: Mentha29_contig00010735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00010735 (899 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45935.1| hypothetical protein MIMGU_mgv1a002701mg [Mimulus... 48 1e-09 >gb|EYU45935.1| hypothetical protein MIMGU_mgv1a002701mg [Mimulus guttatus] Length = 646 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -3 Query: 834 LFQPTLGKYDVTKCTDLIGMKNATAAAITHFSSTPAAA 721 LF+P +GKY +KC+DLIG+ N AA++ FSSTPAAA Sbjct: 612 LFKPNVGKYGGSKCSDLIGINN---AAVSRFSSTPAAA 646 Score = 42.0 bits (97), Expect(2) = 1e-09 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 898 LRWKTCQLIVEAIVPPYKSYL 836 LRWKTCQLIVE+I+ PYK YL Sbjct: 569 LRWKTCQLIVESIIAPYKRYL 589