BLASTX nr result
ID: Mentha29_contig00010189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00010189 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468487.1| PREDICTED: glycine cleavage system H protein... 65 1e-08 ref|XP_004293760.1| PREDICTED: glycine cleavage system H protein... 63 5e-08 ref|XP_007212189.1| hypothetical protein PRUPE_ppa012788mg [Prun... 63 5e-08 gb|EYU22153.1| hypothetical protein MIMGU_mgv1a015161mg [Mimulus... 62 1e-07 ref|XP_006295389.1| hypothetical protein CARUB_v10024485mg [Caps... 62 1e-07 ref|XP_002881376.1| hypothetical protein ARALYDRAFT_482477 [Arab... 62 1e-07 ref|XP_002278252.1| PREDICTED: glycine cleavage system H protein... 62 1e-07 ref|NP_181057.1| glycine cleavage system H protein 2 [Arabidopsi... 62 1e-07 ref|XP_006448700.1| hypothetical protein CICLE_v10017047mg [Citr... 61 1e-07 ref|XP_004145438.1| PREDICTED: glycine cleavage system H protein... 61 1e-07 ref|NP_001141253.1| hypothetical protein [Zea mays] gi|194703550... 61 1e-07 ref|XP_006436757.1| hypothetical protein CICLE_v10032942mg [Citr... 60 2e-07 ref|XP_006415191.1| hypothetical protein EUTSA_v10008944mg [Eutr... 60 2e-07 gb|AFW60522.1| hypothetical protein ZEAMMB73_345424 [Zea mays] 60 2e-07 gb|ACR38569.1| unknown [Zea mays] gi|413926443|gb|AFW66375.1| gl... 60 2e-07 ref|NP_001152670.1| glycine cleavage system H protein 1 [Zea may... 60 2e-07 ref|NP_174525.1| probable glycine cleavage system H protein 2 [A... 60 3e-07 ref|XP_003570126.1| PREDICTED: glycine cleavage system H protein... 60 3e-07 gb|EXB68026.1| Glycine cleavage system H protein [Morus notabilis] 60 4e-07 ref|NP_181080.1| glycine decarboxylase complex protein H [Arabid... 60 4e-07 >ref|XP_006468487.1| PREDICTED: glycine cleavage system H protein 2, mitochondrial-like [Citrus sinensis] Length = 155 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 + SP LVN SPYEDGWI+KVE++N GEL LMD D YTKFC Sbjct: 108 SSSPALVNSSPYEDGWIIKVEMDNAGELKKLMDADQYTKFC 148 >ref|XP_004293760.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like isoform 2 [Fragaria vesca subsp. vesca] Length = 152 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 337 SPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 SPGLVN SPYE GWI+KVE+ + GEL LMD D YTKFC Sbjct: 108 SPGLVNSSPYEKGWIIKVEINDSGELKNLMDSDKYTKFC 146 >ref|XP_007212189.1| hypothetical protein PRUPE_ppa012788mg [Prunus persica] gi|462408054|gb|EMJ13388.1| hypothetical protein PRUPE_ppa012788mg [Prunus persica] Length = 154 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 337 SPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 SPGLVN SPYEDGWI+KVE+ + GE+ LMD + YTKFC Sbjct: 110 SPGLVNSSPYEDGWIIKVEISDSGEVKKLMDSEKYTKFC 148 >gb|EYU22153.1| hypothetical protein MIMGU_mgv1a015161mg [Mimulus guttatus] Length = 166 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TESPGL+N SPYEDGW++KV+ N EL LM P YTKFC Sbjct: 119 TESPGLINSSPYEDGWMIKVKPSNPSELESLMGPKEYTKFC 159 >ref|XP_006295389.1| hypothetical protein CARUB_v10024485mg [Capsella rubella] gi|482564097|gb|EOA28287.1| hypothetical protein CARUB_v10024485mg [Capsella rubella] Length = 156 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TESPGLVN SPYE GWI+KVE+ + GE LMD D Y+KFC Sbjct: 109 TESPGLVNSSPYEQGWIVKVELSDAGEAEKLMDSDKYSKFC 149 >ref|XP_002881376.1| hypothetical protein ARALYDRAFT_482477 [Arabidopsis lyrata subsp. lyrata] gi|297327215|gb|EFH57635.1| hypothetical protein ARALYDRAFT_482477 [Arabidopsis lyrata subsp. lyrata] Length = 156 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TESPGLVN SPYE GWI+KVE+ + GE LMD D Y+KFC Sbjct: 109 TESPGLVNSSPYEQGWIIKVELSDAGEAEKLMDSDKYSKFC 149 >ref|XP_002278252.1| PREDICTED: glycine cleavage system H protein, mitochondrial [Vitis vinifera] gi|297737954|emb|CBI27155.3| unnamed protein product [Vitis vinifera] Length = 154 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 337 SPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 SPGLVN SPYE+GWI+KVE+ + GEL LMD + YTKFC Sbjct: 109 SPGLVNASPYENGWIIKVEMSDTGELNSLMDSEQYTKFC 147 >ref|NP_181057.1| glycine cleavage system H protein 2 [Arabidopsis thaliana] gi|75220222|sp|O82179.1|GCSH2_ARATH RecName: Full=Glycine cleavage system H protein 2, mitochondrial; Flags: Precursor gi|3668097|gb|AAC61829.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana] gi|15810184|gb|AAL06993.1| At2g35120/T4C15.21 [Arabidopsis thaliana] gi|16974361|gb|AAL31106.1| At2g35120/T4C15.21 [Arabidopsis thaliana] gi|110743799|dbj|BAE99735.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana] gi|330253973|gb|AEC09067.1| glycine decarboxylase complex protein H2 [Arabidopsis thaliana] Length = 156 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TESPGLVN SPYE GWI+KVE+ + GE LMD D Y+KFC Sbjct: 109 TESPGLVNSSPYEQGWIIKVELSDAGEAEKLMDSDKYSKFC 149 >ref|XP_006448700.1| hypothetical protein CICLE_v10017047mg [Citrus clementina] gi|557551311|gb|ESR61940.1| hypothetical protein CICLE_v10017047mg [Citrus clementina] Length = 155 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 + SP LVN SPY+DGWI+KVE+++ GEL LMD D YTKFC Sbjct: 108 SSSPALVNSSPYKDGWIIKVEMDSAGELKKLMDADQYTKFC 148 >ref|XP_004145438.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like [Cucumis sativus] Length = 155 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 + SPGLVN SPYE+GWI+KVEV + GEL LMD + Y+KFC Sbjct: 108 SSSPGLVNSSPYENGWIIKVEVSDSGELKKLMDSEQYSKFC 148 >ref|NP_001141253.1| hypothetical protein [Zea mays] gi|194703550|gb|ACF85859.1| unknown [Zea mays] gi|413935737|gb|AFW70288.1| hypothetical protein ZEAMMB73_241255 [Zea mays] Length = 159 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 +E PGLVN SPYE GWI+KV++ N G+L LMD D Y+KFC Sbjct: 113 SEEPGLVNASPYEKGWIIKVKLSNSGDLNSLMDDDKYSKFC 153 >ref|XP_006436757.1| hypothetical protein CICLE_v10032942mg [Citrus clementina] gi|568864066|ref|XP_006485430.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like [Citrus sinensis] gi|557538953|gb|ESR49997.1| hypothetical protein CICLE_v10032942mg [Citrus clementina] Length = 162 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TE+PGLVN SPYE+GW++KV+ + +L LMDP YTKFC Sbjct: 115 TETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFC 155 >ref|XP_006415191.1| hypothetical protein EUTSA_v10008944mg [Eutrema salsugineum] gi|557092962|gb|ESQ33544.1| hypothetical protein EUTSA_v10008944mg [Eutrema salsugineum] Length = 166 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 T+SPGL+N SPYEDGW++KV+ N EL LM P YTKFC Sbjct: 119 TDSPGLINSSPYEDGWMIKVKPSNPAELESLMGPKEYTKFC 159 >gb|AFW60522.1| hypothetical protein ZEAMMB73_345424 [Zea mays] Length = 177 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 +E PGLVN SPYE GWI+KV++ + GEL LMD D Y+KFC Sbjct: 85 SEEPGLVNASPYEKGWIIKVKLSDSGELSSLMDGDKYSKFC 125 >gb|ACR38569.1| unknown [Zea mays] gi|413926443|gb|AFW66375.1| glycine cleavage system H protein 1 [Zea mays] Length = 160 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 +E PGLVN SPYE GWI+KV++ + GEL LMD D Y+KFC Sbjct: 114 SEEPGLVNASPYEKGWIIKVKLSDSGELSSLMDGDKYSKFC 154 >ref|NP_001152670.1| glycine cleavage system H protein 1 [Zea mays] gi|195658725|gb|ACG48830.1| glycine cleavage system H protein 1 [Zea mays] Length = 160 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 +E PGLVN SPYE GWI+KV++ + GEL LMD D Y+KFC Sbjct: 114 SEEPGLVNASPYEKGWIIKVKLSDSGELSSLMDGDKYSKFC 154 >ref|NP_174525.1| probable glycine cleavage system H protein 2 [Arabidopsis thaliana] gi|12644523|sp|Q9LQL0.1|GCSH3_ARATH RecName: Full=Glycine cleavage system H protein 3, mitochondrial; Flags: Precursor gi|8920623|gb|AAF81345.1|AC007767_25 Identical to a glycine cleavage system H-protein precursor from Arabidopsis thaliana gb|P25855. It contains a glycine cleavage H-protein domain PF|01597. ESTs gb|R90208, gb|AI994794, gb|AA605324, gb|N38240, gb|AV533336, gb|AV534187, gb|AA597419 and gb|AA597515 come from this gene [Arabidopsis thaliana] gi|12083338|gb|AAG48828.1|AF332465_1 putative glycine cleavage system H protein precursor [Arabidopsis thaliana] gi|14326572|gb|AAK60330.1|AF385740_1 At1g32470/F5D14_10 [Arabidopsis thaliana] gi|18700238|gb|AAL77729.1| At1g32470/F5D14_10 [Arabidopsis thaliana] gi|332193369|gb|AEE31490.1| probable glycine cleavage system H protein 2 [Arabidopsis thaliana] Length = 166 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TESPGL+N SPYEDGW++KV+ + EL LM P YTKFC Sbjct: 119 TESPGLINSSPYEDGWMIKVKPSSPAELEALMGPKEYTKFC 159 >ref|XP_003570126.1| PREDICTED: glycine cleavage system H protein, mitochondrial-like [Brachypodium distachyon] Length = 158 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TE PGLVN +PYE GWI+KV+V++ GEL LMD + Y+KFC Sbjct: 111 TEKPGLVNANPYEGGWIIKVKVKDAGELNSLMDDEKYSKFC 151 >gb|EXB68026.1| Glycine cleavage system H protein [Morus notabilis] Length = 155 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 337 SPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 SPGL+N SPYE GWIMK+EV + GE+ LMD D Y+KFC Sbjct: 110 SPGLINSSPYEKGWIMKLEVSSGGEVNGLMDADQYSKFC 148 >ref|NP_181080.1| glycine decarboxylase complex protein H [Arabidopsis thaliana] gi|121075|sp|P25855.1|GCSH1_ARATH RecName: Full=Glycine cleavage system H protein 1, mitochondrial; Flags: Precursor gi|166725|gb|AAA32802.1| H-Protein precursor [Arabidopsis thaliana] gi|861215|gb|AAA87942.1| glycine decarboxylase complex H-protein precursor [Arabidopsis thaliana] gi|3608151|gb|AAC36184.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana] gi|15215833|gb|AAK91461.1| At2g35370/T32F12.25 [Arabidopsis thaliana] gi|16604472|gb|AAL24242.1| At2g35370/T32F12.25 [Arabidopsis thaliana] gi|20453253|gb|AAM19865.1| At2g35370/T32F12.25 [Arabidopsis thaliana] gi|21592462|gb|AAM64413.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana] gi|110736863|dbj|BAF00389.1| glycine decarboxylase complex H-protein [Arabidopsis thaliana] gi|330254006|gb|AEC09100.1| glycine decarboxylase complex protein H [Arabidopsis thaliana] gi|445119|prf||1908425A Gly decarboxylase:SUBUNIT=H protein Length = 165 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 343 TESPGLVNLSPYEDGWIMKVEVENDGELLCLMDPDGYTKFC 221 TESPGL+N SPYEDGW++KV+ + EL LM P YTKFC Sbjct: 118 TESPGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFC 158