BLASTX nr result
ID: Mentha29_contig00010171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00010171 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051462.1| SAUR-like auxin-responsive protein family [T... 78 1e-12 ref|XP_006350722.1| PREDICTED: indole-3-acetic acid-induced prot... 77 3e-12 ref|XP_007135297.1| hypothetical protein PHAVU_010G117500g [Phas... 77 3e-12 ref|XP_004510629.1| PREDICTED: auxin-induced protein 10A5-like [... 77 3e-12 ref|XP_003528773.1| PREDICTED: auxin-induced protein 10A5-like [... 77 3e-12 ref|XP_003627497.1| Auxin-induced protein 10A5 [Medicago truncat... 77 3e-12 ref|XP_007147345.1| hypothetical protein PHAVU_006G116200g [Phas... 76 6e-12 ref|XP_002320219.1| auxin-responsive family protein [Populus tri... 76 6e-12 ref|XP_002301429.2| auxin-responsive family protein [Populus tri... 75 7e-12 ref|XP_007039174.1| SAUR family protein [Theobroma cacao] gi|508... 75 7e-12 gb|EXB43114.1| hypothetical protein L484_002582 [Morus notabilis] 75 1e-11 ref|XP_006444768.1| hypothetical protein CICLE_v10022948mg [Citr... 75 1e-11 ref|XP_007218591.1| hypothetical protein PRUPE_ppa013301mg [Prun... 75 1e-11 ref|XP_007218348.1| hypothetical protein PRUPE_ppa010986mg [Prun... 75 1e-11 ref|XP_002872922.1| auxin-responsive family protein [Arabidopsis... 75 1e-11 gb|EYU19681.1| hypothetical protein MIMGU_mgv1a016283mg [Mimulus... 75 1e-11 gb|EXB83845.1| hypothetical protein L484_023452 [Morus notabilis] 74 2e-11 ref|XP_004494852.1| PREDICTED: auxin-induced protein 10A5-like [... 74 2e-11 ref|XP_002318465.1| hypothetical protein POPTR_0012s03050g [Popu... 74 2e-11 ref|XP_003626587.1| Auxin-induced protein X15 [Medicago truncatu... 74 2e-11 >ref|XP_007051462.1| SAUR-like auxin-responsive protein family [Theobroma cacao] gi|508703723|gb|EOX95619.1| SAUR-like auxin-responsive protein family [Theobroma cacao] Length = 115 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR VRGLID E Sbjct: 61 PLFMQLLKEAEEEYGFDQKGTITIPCHVEEFRNVRGLIDRE 101 >ref|XP_006350722.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum tuberosum] Length = 122 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEEATS 306 PLF QLLKEAEEEYGFD G INIPCH+EEFR V+G+ID+E TS Sbjct: 65 PLFMQLLKEAEEEYGFDHNGPINIPCHIEEFRHVQGIIDKETTS 108 >ref|XP_007135297.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris] gi|561008342|gb|ESW07291.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris] Length = 108 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR VRGLID + Sbjct: 54 PLFMQLLKEAEEEYGFDQKGTITIPCHVEEFRNVRGLIDRD 94 >ref|XP_004510629.1| PREDICTED: auxin-induced protein 10A5-like [Cicer arietinum] Length = 107 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR VRGLID + Sbjct: 55 PLFIQLLKEAEEEYGFDQKGTITIPCHVEEFRNVRGLIDRD 95 >ref|XP_003528773.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max] Length = 115 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR VRGLID + Sbjct: 57 PLFMQLLKEAEEEYGFDQKGTITIPCHVEEFRNVRGLIDRD 97 >ref|XP_003627497.1| Auxin-induced protein 10A5 [Medicago truncatula] gi|217075144|gb|ACJ85932.1| unknown [Medicago truncatula] gi|355521519|gb|AET01973.1| Auxin-induced protein 10A5 [Medicago truncatula] gi|388491478|gb|AFK33805.1| unknown [Medicago truncatula] Length = 108 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR VRGLID + Sbjct: 55 PLFIQLLKEAEEEYGFDQKGTITIPCHVEEFRNVRGLIDRD 95 >ref|XP_007147345.1| hypothetical protein PHAVU_006G116200g [Phaseolus vulgaris] gi|561020568|gb|ESW19339.1| hypothetical protein PHAVU_006G116200g [Phaseolus vulgaris] Length = 105 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCH+EEFR VRG+ID E Sbjct: 51 PLFMQLLKEAEEEYGFDQKGTIAIPCHIEEFRSVRGIIDSE 91 >ref|XP_002320219.1| auxin-responsive family protein [Populus trichocarpa] gi|222860992|gb|EEE98534.1| auxin-responsive family protein [Populus trichocarpa] Length = 110 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I+IPCHVEEFR V+G+ID E Sbjct: 56 PLFIQLLKEAEEEYGFDQKGTISIPCHVEEFRNVQGMIDRE 96 >ref|XP_002301429.2| auxin-responsive family protein [Populus trichocarpa] gi|550345239|gb|EEE80702.2| auxin-responsive family protein [Populus trichocarpa] Length = 113 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR V+G+ID+E Sbjct: 60 PLFIQLLKEAEEEYGFDQKGTITIPCHVEEFRYVQGMIDKE 100 >ref|XP_007039174.1| SAUR family protein [Theobroma cacao] gi|508776419|gb|EOY23675.1| SAUR family protein [Theobroma cacao] Length = 122 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR V+G+ID+E Sbjct: 60 PLFMQLLKEAEEEYGFDQKGPITIPCHVEEFRNVQGMIDKE 100 >gb|EXB43114.1| hypothetical protein L484_002582 [Morus notabilis] Length = 145 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR V+G+ID+E Sbjct: 80 PLFMQLLKEAEEEYGFDQKGPITIPCHVEEFRTVQGIIDKE 120 >ref|XP_006444768.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] gi|567904562|ref|XP_006444769.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] gi|568876553|ref|XP_006491342.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like isoform X1 [Citrus sinensis] gi|568876555|ref|XP_006491343.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like isoform X2 [Citrus sinensis] gi|557547030|gb|ESR58008.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] gi|557547031|gb|ESR58009.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] Length = 112 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR V+G+ID E Sbjct: 58 PLFMQLLKEAEEEYGFDQKGTITIPCHVEEFRYVQGMIDRE 98 >ref|XP_007218591.1| hypothetical protein PRUPE_ppa013301mg [Prunus persica] gi|462415053|gb|EMJ19790.1| hypothetical protein PRUPE_ppa013301mg [Prunus persica] Length = 130 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEEAT 309 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR V+G+ID E + Sbjct: 65 PLFMQLLKEAEEEYGFDQKGPITIPCHVEEFRTVQGMIDRETS 107 >ref|XP_007218348.1| hypothetical protein PRUPE_ppa010986mg [Prunus persica] gi|462414810|gb|EMJ19547.1| hypothetical protein PRUPE_ppa010986mg [Prunus persica] Length = 228 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR V+G+ID E Sbjct: 168 PLFIQLLKEAEEEYGFDQKGTITIPCHVEEFRYVQGMIDRE 208 >ref|XP_002872922.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297318759|gb|EFH49181.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata] Length = 122 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEEAT 309 PLF QLLKEAEEE+GF QKG I IPCHVEEFR VRGLID E T Sbjct: 56 PLFVQLLKEAEEEFGFSQKGTITIPCHVEEFRYVRGLIDRENT 98 >gb|EYU19681.1| hypothetical protein MIMGU_mgv1a016283mg [Mimulus guttatus] Length = 127 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEEATS 306 PLF QLLKEAEEEYGFD G INIPCHVE+F VRG+ID+EAT+ Sbjct: 61 PLFVQLLKEAEEEYGFDHDGPINIPCHVEDFCHVRGVIDKEATA 104 >gb|EXB83845.1| hypothetical protein L484_023452 [Morus notabilis] Length = 128 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFDQKG I IPCHVEEFR V+G+ID E Sbjct: 71 PLFMQLLKEAEEEYGFDQKGTIIIPCHVEEFRYVQGMIDRE 111 >ref|XP_004494852.1| PREDICTED: auxin-induced protein 10A5-like [Cicer arietinum] Length = 93 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF LLKEAEEE+GFDQKG I IPCHVEEFR +RGLID E Sbjct: 41 PLFMHLLKEAEEEFGFDQKGTITIPCHVEEFRNIRGLIDRE 81 >ref|XP_002318465.1| hypothetical protein POPTR_0012s03050g [Populus trichocarpa] gi|222859138|gb|EEE96685.1| hypothetical protein POPTR_0012s03050g [Populus trichocarpa] Length = 135 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEEATS 306 PLF QLLKEAEEE+GFDQ+G I IPCHVEEFR V+G+I+EE +S Sbjct: 70 PLFMQLLKEAEEEFGFDQEGPITIPCHVEEFRNVQGMIEEEKSS 113 >ref|XP_003626587.1| Auxin-induced protein X15 [Medicago truncatula] gi|355501602|gb|AES82805.1| Auxin-induced protein X15 [Medicago truncatula] Length = 105 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -3 Query: 437 PLFTQLLKEAEEEYGFDQKGAINIPCHVEEFRQVRGLIDEE 315 PLF QLLKEAEEEYGFD KGAI IPC VEEFR +RGLID E Sbjct: 51 PLFMQLLKEAEEEYGFDHKGAITIPCRVEEFRNIRGLIDRE 91