BLASTX nr result
ID: Mentha29_contig00010099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00010099 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447226.1| hypothetical protein CICLE_v10017238mg [Citr... 56 6e-06 >ref|XP_006447226.1| hypothetical protein CICLE_v10017238mg [Citrus clementina] gi|568831316|ref|XP_006469916.1| PREDICTED: uncharacterized protein LOC102614119 isoform X3 [Citrus sinensis] gi|557549837|gb|ESR60466.1| hypothetical protein CICLE_v10017238mg [Citrus clementina] Length = 97 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = +1 Query: 4 PYHTATASALMMSMLTVSRCGFGWLPDGCDD 96 PYHTATASAL S+L++S+CG+GWLP+ C+D Sbjct: 65 PYHTATASALSTSLLSISQCGYGWLPEACND 95