BLASTX nr result
ID: Mentha29_contig00010094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00010094 (653 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18035.1| hypothetical protein MIMGU_mgv1a015499mg [Mimulus... 59 1e-06 gb|EYU24314.1| hypothetical protein MIMGU_mgv1a019666mg [Mimulus... 59 2e-06 >gb|EYU18035.1| hypothetical protein MIMGU_mgv1a015499mg [Mimulus guttatus] Length = 156 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = +2 Query: 2 DEASSSTRRLT--EWPTIDGPLGLSHADSVTYAVRFFKLGYFLL 127 D+ + S+ RL+ EWPTIDGPLGLSH DS+ YA RFFKLG+ L Sbjct: 31 DDVAPSSSRLSRVEWPTIDGPLGLSHEDSLAYARRFFKLGFLCL 74 >gb|EYU24314.1| hypothetical protein MIMGU_mgv1a019666mg [Mimulus guttatus] Length = 156 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = +2 Query: 2 DEASSSTRRLT--EWPTIDGPLGLSHADSVTYAVRFFKLGYFLL 127 D+ + S+ RL EWPTIDGPLGLSH DS+ YA RFFKLG+ L Sbjct: 31 DDIAPSSSRLARVEWPTIDGPLGLSHEDSLAYARRFFKLGFLCL 74