BLASTX nr result
ID: Mentha29_contig00009466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00009466 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31827.1| hypothetical protein MIMGU_mgv1a014958mg [Mimulus... 66 4e-09 ref|XP_007045145.1| Nudix hydrolase [Theobroma cacao] gi|5087090... 55 8e-06 >gb|EYU31827.1| hypothetical protein MIMGU_mgv1a014958mg [Mimulus guttatus] Length = 172 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 QAVDYKRPTYEEVMKTFQPYFGSGKATKSYSSKW 102 QAVDYKRPTYEEVMK F+PYF SGKATK YS+KW Sbjct: 139 QAVDYKRPTYEEVMKKFRPYFDSGKATKCYSTKW 172 >ref|XP_007045145.1| Nudix hydrolase [Theobroma cacao] gi|508709080|gb|EOY00977.1| Nudix hydrolase [Theobroma cacao] Length = 173 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +1 Query: 1 QAVDYKRPTYEEVMKTFQPYFG-SGKATKSYSSKW 102 QAVDYKRPTYEEVMKTF+PYF + KA K S+KW Sbjct: 139 QAVDYKRPTYEEVMKTFRPYFSDNSKAAKCKSTKW 173