BLASTX nr result
ID: Mentha29_contig00008694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00008694 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34950.1| hypothetical protein MIMGU_mgv1a008823mg [Mimulus... 56 5e-06 >gb|EYU34950.1| hypothetical protein MIMGU_mgv1a008823mg [Mimulus guttatus] Length = 361 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 208 RPRMYKKVRNYPEVYFHYYQQGKRPIDAVR 119 +PR++KKV+NYPE YF YYQQ KRPIDAVR Sbjct: 331 KPRLFKKVKNYPETYFQYYQQMKRPIDAVR 360