BLASTX nr result
ID: Mentha29_contig00008298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00008298 (509 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59955.1| hypothetical protein M569_14851 [Genlisea aurea] 56 5e-06 >gb|EPS59955.1| hypothetical protein M569_14851 [Genlisea aurea] Length = 168 Score = 56.2 bits (134), Expect = 5e-06 Identities = 45/106 (42%), Positives = 54/106 (50%), Gaps = 7/106 (6%) Frame = -3 Query: 507 GALAMGNVTLLRRGESLDSLATKIGGSNSRDPTRSDSE-LVAPLKVR------KAVPPPK 349 G L G VTLLRRGESLDSLA + S DP + + E +V P K+ + P P Sbjct: 67 GGLVSGKVTLLRRGESLDSLAKIL--HRSPDPKQPEPEPVVIPAKIHHLPNQIRLSPAPF 124 Query: 348 VDVYAGAAFDXXXXXXXXXXXSFCGMKGGASDDDDATRSLRRMLGL 211 DVYAG+AF SF + A D AT+ LRRML L Sbjct: 125 RDVYAGSAFYSSPSPRSLPLPSFFNKRDPA---DSATQDLRRMLRL 167