BLASTX nr result
ID: Mentha29_contig00008249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00008249 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK43955.1| unknown [Lotus japonicus] 74 2e-11 ref|XP_003588785.1| 14 kDa proline-rich protein DC2.15 [Medicago... 74 2e-11 ref|XP_003588784.1| 14 kDa proline-rich protein DC2.15 [Medicago... 74 2e-11 ref|XP_003588779.1| 14 kDa proline-rich protein DC2.15 [Medicago... 74 2e-11 emb|CBI31904.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002271792.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 74 2e-11 ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 74 3e-11 ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citr... 74 3e-11 gb|ABG91752.1| HyPRP2 [Gossypium hirsutum] 74 3e-11 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis] 73 4e-11 ref|XP_004498751.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 73 4e-11 gb|AAA32650.1| bimodular protein [Medicago sativa] 73 4e-11 gb|ABQ01426.1| bimodular protein [Medicago falcata] 73 4e-11 gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Mimulus... 73 5e-11 gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Mimulus... 73 5e-11 ref|XP_007161198.1| hypothetical protein PHAVU_001G050300g [Phas... 73 5e-11 ref|XP_006398386.1| hypothetical protein EUTSA_v10001071mg [Eutr... 73 5e-11 ref|XP_006289530.1| hypothetical protein CARUB_v10003073mg [Caps... 73 5e-11 ref|XP_006282240.1| hypothetical protein CARUB_v10028513mg [Caps... 73 5e-11 ref|XP_003588783.1| 14 kDa proline-rich protein DC2.15 [Medicago... 73 5e-11 >gb|AFK43955.1| unknown [Lotus japonicus] Length = 128 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTA+KAN+LGINLNVP++LS++LSACQK VPSGFQ A Sbjct: 88 AVCLCTAVKANVLGINLNVPVTLSVLLSACQKTVPSGFQCA 128 >ref|XP_003588785.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477833|gb|AES59036.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|388496896|gb|AFK36514.1| unknown [Medicago truncatula] gi|388514065|gb|AFK45094.1| unknown [Medicago truncatula] Length = 151 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 A+CLCTAIKAN+LGINLNVPI+LSL+LSAC+K VPSGFQ Sbjct: 111 AICLCTAIKANVLGINLNVPITLSLLLSACEKSVPSGFQ 149 >ref|XP_003588784.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477832|gb|AES59035.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] Length = 164 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 AVCLCTAIKAN+LGINLNVP++LSL+LSACQK VP+GFQ Sbjct: 124 AVCLCTAIKANVLGINLNVPVTLSLLLSACQKSVPNGFQ 162 >ref|XP_003588779.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477827|gb|AES59030.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] Length = 210 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 AVCLCTAIKAN+LGINLNVP++LSL+LSACQK VP+GFQ Sbjct: 170 AVCLCTAIKANVLGINLNVPVTLSLLLSACQKSVPNGFQ 208 >emb|CBI31904.3| unnamed protein product [Vitis vinifera] Length = 111 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTAIKAN+LGINLN+P+SLSL+L+ C KKVPSGFQ A Sbjct: 71 AVCLCTAIKANVLGINLNIPLSLSLLLNVCSKKVPSGFQCA 111 >ref|XP_002271792.1| PREDICTED: 14 kDa proline-rich protein DC2.15 isoform 1 [Vitis vinifera] gi|359474359|ref|XP_003631442.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera] gi|147854119|emb|CAN80710.1| hypothetical protein VITISV_033377 [Vitis vinifera] Length = 135 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTAIKAN+LGINLN+P+SLSL+L+ C KKVPSGFQ A Sbjct: 95 AVCLCTAIKANVLGINLNIPLSLSLLLNVCSKKVPSGFQCA 135 >ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis] Length = 134 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTAIKANILGINLNVP+SLSL+L+ C KKVPSGFQ A Sbjct: 94 AVCLCTAIKANILGINLNVPVSLSLLLNFCGKKVPSGFQCA 134 >ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina] gi|557542611|gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina] Length = 131 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTAIKANILGINLNVP+SLSL+L+ C KKVPSGFQ A Sbjct: 91 AVCLCTAIKANILGINLNVPVSLSLLLNFCGKKVPSGFQCA 131 >gb|ABG91752.1| HyPRP2 [Gossypium hirsutum] Length = 137 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 AVCLCTAIKANILGINLNVP+SLSL+L+ C KKVPSGFQ Sbjct: 97 AVCLCTAIKANILGINLNVPLSLSLLLNVCSKKVPSGFQ 135 >gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis] Length = 114 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTAIKANILGINLN+PISLSL++S C+K +PSGFQ A Sbjct: 74 AVCLCTAIKANILGINLNIPISLSLLISTCRKDIPSGFQCA 114 >ref|XP_004498751.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum] Length = 126 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 A+CLCTAIKAN+LGINLNVPI+LSL+LSACQK +PSGF+ Sbjct: 86 AICLCTAIKANVLGINLNVPITLSLLLSACQKSIPSGFK 124 >gb|AAA32650.1| bimodular protein [Medicago sativa] Length = 166 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 AVCLCTAIKANILGINLNVPI+LSL+LSAC+K +P+GFQ Sbjct: 126 AVCLCTAIKANILGINLNVPITLSLLLSACEKSIPNGFQ 164 >gb|ABQ01426.1| bimodular protein [Medicago falcata] Length = 166 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 AVCLCTAIKANILGINLNVPI+LSL+LSAC+K +P+GFQ Sbjct: 126 AVCLCTAIKANILGINLNVPITLSLLLSACEKSIPNGFQ 164 >gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Mimulus guttatus] Length = 132 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTA+KAN+LGINLNVP+SLSL+L+ C KKVPSGFQ A Sbjct: 92 AVCLCTAVKANVLGINLNVPVSLSLLLNYCGKKVPSGFQCA 132 >gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Mimulus guttatus] Length = 132 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTA+KAN+LGINLNVP+SLSL+L+ C KKVPSGFQ A Sbjct: 92 AVCLCTAVKANVLGINLNVPVSLSLLLNYCGKKVPSGFQCA 132 >ref|XP_007161198.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris] gi|561034662|gb|ESW33192.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris] Length = 121 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 A+CLCTAIKAN+LGINLNVPI+LS++LSACQK VPSGFQ Sbjct: 81 ALCLCTAIKANVLGINLNVPITLSVLLSACQKTVPSGFQ 119 >ref|XP_006398386.1| hypothetical protein EUTSA_v10001071mg [Eutrema salsugineum] gi|557099475|gb|ESQ39839.1| hypothetical protein EUTSA_v10001071mg [Eutrema salsugineum] Length = 129 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTA+KAN+LGINLNVP+SLSLIL+ C KKVPSGFQ A Sbjct: 89 AVCLCTALKANLLGINLNVPVSLSLILNHCGKKVPSGFQCA 129 >ref|XP_006289530.1| hypothetical protein CARUB_v10003073mg [Capsella rubella] gi|482558236|gb|EOA22428.1| hypothetical protein CARUB_v10003073mg [Capsella rubella] Length = 159 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 A+CLCTA+KAN+LGINLNVPISLS++L+ C KKVPSGFQ A Sbjct: 119 AICLCTALKANVLGINLNVPISLSVLLNVCDKKVPSGFQCA 159 >ref|XP_006282240.1| hypothetical protein CARUB_v10028513mg [Capsella rubella] gi|482550944|gb|EOA15138.1| hypothetical protein CARUB_v10028513mg [Capsella rubella] Length = 129 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQSA 125 AVCLCTA+KAN+LGINLNVPISLSL+L+ C KKVPSGFQ A Sbjct: 89 AVCLCTALKANLLGINLNVPISLSLVLNNCGKKVPSGFQCA 129 >ref|XP_003588783.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] gi|355477831|gb|AES59034.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula] Length = 154 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +3 Query: 3 AVCLCTAIKANILGINLNVPISLSLILSACQKKVPSGFQ 119 AVCLCTAIKAN+LGINLNVP++LSL+LSAC+K VP+GFQ Sbjct: 114 AVCLCTAIKANVLGINLNVPVTLSLLLSACEKSVPNGFQ 152