BLASTX nr result
ID: Mentha29_contig00008112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00008112 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236075.1| uncharacterized protein LOC100305485 precurs... 60 2e-07 ref|XP_006401051.1| hypothetical protein EUTSA_v10014704mg [Eutr... 60 3e-07 gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitat... 60 3e-07 ref|XP_002864586.1| hypothetical protein ARALYDRAFT_495994 [Arab... 60 3e-07 ref|XP_006281118.1| hypothetical protein CARUB_v10027149mg [Caps... 60 4e-07 ref|NP_200679.1| cyclophilin ROC7 [Arabidopsis thaliana] gi|7531... 60 4e-07 ref|XP_006410046.1| hypothetical protein EUTSA_v10016970mg [Eutr... 59 7e-07 ref|XP_006848226.1| hypothetical protein AMTR_s00029p00245680 [A... 59 7e-07 ref|XP_006294680.1| hypothetical protein CARUB_v10023717mg [Caps... 59 7e-07 gb|AAB71401.1| cyclophilin [Arabidopsis thaliana] 59 7e-07 ref|NP_180557.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Ar... 59 7e-07 ref|XP_002881077.1| cyclophilin [Arabidopsis lyrata subsp. lyrat... 59 7e-07 ref|NP_001077978.1| peptidyl-prolyl cis-trans isomerase CYP19-4 ... 59 7e-07 gb|AAM63088.1| cyclophilin [Arabidopsis thaliana] 59 7e-07 ref|XP_007146769.1| hypothetical protein PHAVU_006G068200g [Phas... 59 9e-07 ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 9e-07 ref|XP_004294264.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 9e-07 gb|AFK34845.1| unknown [Medicago truncatula] 59 9e-07 gb|AEK80448.1| peptidyl-prolyl cis-trans isomerase [Carica papaya] 59 9e-07 gb|EPS66571.1| peptidyl-prolyl cis-trans isomerase, partial [Gen... 58 1e-06 >ref|NP_001236075.1| uncharacterized protein LOC100305485 precursor [Glycine max] gi|255625651|gb|ACU13170.1| unknown [Glycine max] Length = 204 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVIVDSGE+PL Sbjct: 174 MDVVYKIEAEGTQSGTPKSKVVIVDSGELPL 204 >ref|XP_006401051.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum] gi|557102141|gb|ESQ42504.1| hypothetical protein EUTSA_v10014704mg [Eutrema salsugineum] Length = 204 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVIVDSGE+PL Sbjct: 174 MDVVYKIEAEGNQSGTPKSKVVIVDSGELPL 204 >gb|AFN53672.1| peptidyl-prolyl cis-trans isomerase [Linum usitatissimum] Length = 206 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYK+EAEG QSGTPKSKVVIVDSGE+PL Sbjct: 176 MDVVYKVEAEGKQSGTPKSKVVIVDSGELPL 206 >ref|XP_002864586.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. lyrata] gi|297310421|gb|EFH40845.1| hypothetical protein ARALYDRAFT_495994 [Arabidopsis lyrata subsp. lyrata] Length = 204 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVIVDSGE+PL Sbjct: 174 MDVVYKIEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_006281118.1| hypothetical protein CARUB_v10027149mg [Capsella rubella] gi|482549822|gb|EOA14016.1| hypothetical protein CARUB_v10027149mg [Capsella rubella] Length = 204 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYK+EAEG QSGTPKSKVVIVDSGE+PL Sbjct: 174 MDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|NP_200679.1| cyclophilin ROC7 [Arabidopsis thaliana] gi|75313668|sp|Q9SP02.1|CP20A_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP20-1; Short=PPIase CYP20-1; AltName: Full=Cyclophilin of 20 kDa 1; AltName: Full=Rotamase CYP20-1; AltName: Full=Rotamase cyclophilin-7; Flags: Precursor gi|6180043|gb|AAF05760.1|AF192490_1 cyclophilin [Arabidopsis thaliana] gi|8843791|dbj|BAA97339.1| cyclophilin [Arabidopsis thaliana] gi|15081670|gb|AAK82490.1| AT5g58710/mzn1_160 [Arabidopsis thaliana] gi|20334834|gb|AAM16173.1| AT5g58710/mzn1_160 [Arabidopsis thaliana] gi|21554366|gb|AAM63473.1| cyclophilin ROC7 [Arabidopsis thaliana] gi|332009705|gb|AED97088.1| cyclophilin ROC7 [Arabidopsis thaliana] Length = 204 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYK+EAEG QSGTPKSKVVIVDSGE+PL Sbjct: 174 MDVVYKVEAEGNQSGTPKSKVVIVDSGELPL 204 >ref|XP_006410046.1| hypothetical protein EUTSA_v10016970mg [Eutrema salsugineum] gi|557111215|gb|ESQ51499.1| hypothetical protein EUTSA_v10016970mg [Eutrema salsugineum] Length = 313 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 283 MDVVYKIEAEGKQSGTPKSKVVIADSGELPL 313 >ref|XP_006848226.1| hypothetical protein AMTR_s00029p00245680 [Amborella trichopoda] gi|548851531|gb|ERN09807.1| hypothetical protein AMTR_s00029p00245680 [Amborella trichopoda] Length = 207 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 177 MDVVYKIEAEGRQSGTPKSKVVIADSGELPL 207 >ref|XP_006294680.1| hypothetical protein CARUB_v10023717mg [Capsella rubella] gi|482563388|gb|EOA27578.1| hypothetical protein CARUB_v10023717mg [Capsella rubella] Length = 302 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 272 MDVVYKIEAEGKQSGTPKSKVVIADSGELPL 302 >gb|AAB71401.1| cyclophilin [Arabidopsis thaliana] Length = 201 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 171 MDVVYKIEAEGKQSGTPKSKVVIADSGELPL 201 >ref|NP_180557.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana] gi|84028862|sp|Q8LDP4.2|CP19D_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP19-4; Short=PPIase CYP19-4; AltName: Full=Cyclophilin of 19 kDa 4; AltName: Full=Cyclophilin-5; AltName: Full=Rotamase CYP19-4; Flags: Precursor gi|3420055|gb|AAC31856.1| cyclophilin [Arabidopsis thaliana] gi|15451026|gb|AAK96784.1| cyclophilin [Arabidopsis thaliana] gi|23197720|gb|AAN15387.1| cyclophilin [Arabidopsis thaliana] gi|330253233|gb|AEC08327.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana] Length = 201 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 171 MDVVYKIEAEGKQSGTPKSKVVIADSGELPL 201 >ref|XP_002881077.1| cyclophilin [Arabidopsis lyrata subsp. lyrata] gi|297326916|gb|EFH57336.1| cyclophilin [Arabidopsis lyrata subsp. lyrata] Length = 201 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 171 MDVVYKIEAEGKQSGTPKSKVVIADSGELPL 201 >ref|NP_001077978.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana] gi|330253234|gb|AEC08328.1| peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana] Length = 191 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 161 MDVVYKIEAEGKQSGTPKSKVVIADSGELPL 191 >gb|AAM63088.1| cyclophilin [Arabidopsis thaliana] Length = 201 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 171 MDVVYKIEAEGKQSGTPKSKVVIADSGELPL 201 >ref|XP_007146769.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris] gi|561019992|gb|ESW18763.1| hypothetical protein PHAVU_006G068200g [Phaseolus vulgaris] Length = 204 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYK+EAEG QSGTPKSKVVI DSGE+PL Sbjct: 174 MDVVYKVEAEGRQSGTPKSKVVIADSGELPL 204 >ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cicer arietinum] Length = 204 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 174 MDVVYKIEAEGNQSGTPKSKVVIADSGELPL 204 >ref|XP_004294264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Fragaria vesca subsp. vesca] Length = 204 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYK+EAEG QSGTPKSKV IVDSGE+PL Sbjct: 174 MDVVYKVEAEGSQSGTPKSKVAIVDSGELPL 204 >gb|AFK34845.1| unknown [Medicago truncatula] Length = 203 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+PL Sbjct: 173 MDVVYKIEAEGNQSGTPKSKVVIADSGELPL 203 >gb|AEK80448.1| peptidyl-prolyl cis-trans isomerase [Carica papaya] Length = 208 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYK+EAEG QSGTPKSKVVI DSGE+PL Sbjct: 178 MDVVYKVEAEGRQSGTPKSKVVIADSGELPL 208 >gb|EPS66571.1| peptidyl-prolyl cis-trans isomerase, partial [Genlisea aurea] Length = 184 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 309 MDVVYKIEAEGMQSGTPKSKVVIVDSGEIPL 217 MDVVYKIEAEG QSGTPKSKVVI DSGE+P+ Sbjct: 154 MDVVYKIEAEGKQSGTPKSKVVIADSGELPM 184