BLASTX nr result
ID: Mentha29_contig00007819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007819 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25928.1| hypothetical protein MIMGU_mgv1a014324mg [Mimulus... 57 2e-12 >gb|EYU25928.1| hypothetical protein MIMGU_mgv1a014324mg [Mimulus guttatus] Length = 193 Score = 57.4 bits (137), Expect(2) = 2e-12 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -1 Query: 137 SNVEKNKELLSLAEVEKILHDVNADDVRVITAPKGSEFADYMVIA 3 + + K E+LSL+EV+KIL DV ADDV+VI AP EF DYMVIA Sbjct: 46 NTITKESEMLSLSEVQKILADVGADDVKVIPAPTRCEFTDYMVIA 90 Score = 40.0 bits (92), Expect(2) = 2e-12 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 238 MWSALRGGALSSSHSAIAHQWRNLAASS 155 MWS LR GALSSS S I +Q+RNL++SS Sbjct: 1 MWSVLRAGALSSSSSHITNQFRNLSSSS 28