BLASTX nr result
ID: Mentha29_contig00007373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007373 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||1211235CE ORF 79 92 6e-17 ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabac... 91 1e-16 ref|YP_001430147.1| hypothetical protein CureCp061 [Cuscuta refl... 59 5e-08 ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 62 7e-08 ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia olerac... 62 8e-08 >prf||1211235CE ORF 79 Length = 79 Score = 92.4 bits (228), Expect = 6e-17 Identities = 49/64 (76%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = -3 Query: 234 VMYGIYDKGGVFLLIGHIGPSWTSNCFDLNYPENAL-CIYQKDGQSNLFYFSIQ*KLKEV 58 VMYGIYDKGG HIGPSWTSNCFDLNYPENA+ IYQKDGQSNLF S LKEV Sbjct: 1 VMYGIYDKGGSIDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLDS----LKEV 56 Query: 57 NRVP 46 NRVP Sbjct: 57 NRVP 60 >ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabacum] gi|11466029|ref|NP_054571.1| hypothetical protein NitaCp098 [Nicotiana tabacum] gi|78102586|ref|YP_358726.1| hypothetical protein NisyCp082 [Nicotiana sylvestris] gi|78102613|ref|YP_358752.1| hypothetical protein NisyCp111 [Nicotiana sylvestris] gi|81301616|ref|YP_398912.1| hypothetical protein NitoCp081 [Nicotiana tomentosiformis] gi|81301643|ref|YP_398938.1| hypothetical protein NitoCp109 [Nicotiana tomentosiformis] gi|351653909|ref|YP_004891655.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653954|ref|YP_004891681.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|4388760|emb|CAA77389.1| hypothetical protein [Nicotiana tabacum] gi|4388762|emb|CAA77404.1| hypothetical protein [Nicotiana tabacum] gi|77799613|dbj|BAE46702.1| hypothetical protein [Nicotiana sylvestris] gi|77799640|dbj|BAE46729.1| hypothetical protein [Nicotiana sylvestris] gi|80750975|dbj|BAE48051.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751002|dbj|BAE48078.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453935|gb|AEO95593.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453980|gb|AEO95638.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454046|gb|AEO95703.1| hypothetical protein [synthetic construct] gi|347454089|gb|AEO95746.1| hypothetical protein [synthetic construct] Length = 79 Score = 91.3 bits (225), Expect = 1e-16 Identities = 48/64 (75%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = -3 Query: 234 VMYGIYDKGGVFLLIGHIGPSWTSNCFDLNYPENAL-CIYQKDGQSNLFYFSIQ*KLKEV 58 +MYGIYDKGG HIGPSWTSNCFDLNYPENA+ IYQKDGQSNLF S LKEV Sbjct: 1 MMYGIYDKGGSIDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLDS----LKEV 56 Query: 57 NRVP 46 NRVP Sbjct: 57 NRVP 60 >ref|YP_001430147.1| hypothetical protein CureCp061 [Cuscuta reflexa] gi|156618874|ref|YP_001430155.1| hypothetical protein CureCp070 [Cuscuta reflexa] gi|401482|sp|P32035.1|YCX1_CUSRE RecName: Full=Uncharacterized 6.8 kDa protein in trnL 3'region; AltName: Full=ORF 55 gi|12523|emb|CAA47850.1| unnamed protein product [Cuscuta reflexa] gi|156556051|emb|CAM98434.1| hypothetical protein [Cuscuta reflexa] gi|156556059|emb|CAM98442.1| hypothetical protein [Cuscuta reflexa] gi|1096970|prf||2113216D ORF 55 Length = 55 Score = 58.5 bits (140), Expect(2) = 5e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -2 Query: 187 SYRPELDIQLLRFELSGECLMYISKRWPIKPILFLDSIEAQRGE 56 SYR +LDIQLLRFELSGECL+ ISKRW IKP+ S QRGE Sbjct: 16 SYRTQLDIQLLRFELSGECLIDISKRWTIKPL----SRFTQRGE 55 Score = 24.3 bits (51), Expect(2) = 5e-08 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 227 MEYMTKVEYFY*SVI 183 MEYM +VEY Y SV+ Sbjct: 1 MEYMKRVEYLYRSVM 15 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] gi|134093271|ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] gi|133712108|gb|ABO36751.1| conserved hypothetical protein [Populus trichocarpa] gi|133712133|gb|ABO36776.1| conserved hypothetical protein [Populus trichocarpa] Length = 61 Score = 62.0 bits (149), Expect(2) = 7e-08 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 186 HIGPSWTSNCFDLNYPENALCI-YQKDGQSNLFYFSIQ*KLKE 61 HIGPS TSNCFDLNYPE+AL I YQK+GQSNLF SI+ K E Sbjct: 19 HIGPSQTSNCFDLNYPEDALSILYQKNGQSNLFLDSIEAKRGE 61 Score = 20.4 bits (41), Expect(2) = 7e-08 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 227 MEYMTKVE 204 MEYMTKVE Sbjct: 1 MEYMTKVE 8 >ref|NP_054976.1| hypothetical protein SpolCp072 [Spinacia oleracea] gi|11497597|ref|NP_055003.1| hypothetical protein SpolCp101 [Spinacia oleracea] gi|7636149|emb|CAB88771.1| hypothetical protein [Spinacia oleracea] gi|7636178|emb|CAB88800.1| hypothetical protein [Spinacia oleracea] Length = 57 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 208 WSISIDRSYRPELDIQLLRFELSGECLMYISKRWPIK 98 WSISIDRSYRP DIQLLRF LSG L+YISKRW IK Sbjct: 10 WSISIDRSYRPGSDIQLLRFALSGGYLIYISKRWTIK 46