BLASTX nr result
ID: Mentha29_contig00007302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007302 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Mimulus... 66 6e-09 >gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Mimulus guttatus] Length = 498 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -1 Query: 120 LTPELLRAVAVIQKFRSTIVEDPLGVTKTWNGRICFDKS 4 LTPELL AV VI+KFR TI +DPLGVTKTW GRIC DKS Sbjct: 123 LTPELLVAVKVIEKFRQTITKDPLGVTKTWKGRICADKS 161