BLASTX nr result
ID: Mentha29_contig00007276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007276 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20128.1| hypothetical protein MIMGU_mgv1a010128mg [Mimulus... 69 9e-10 gb|AAF61863.1|AF193770_1 DNA-binding protein 3 [Nicotiana tabacum] 60 4e-07 >gb|EYU20128.1| hypothetical protein MIMGU_mgv1a010128mg [Mimulus guttatus] Length = 321 Score = 68.6 bits (166), Expect = 9e-10 Identities = 42/78 (53%), Positives = 54/78 (69%), Gaps = 3/78 (3%) Frame = +3 Query: 6 NFHAKKRKAMVELVKGKEIAIQLQTLLNEPVQD---HGPVSPRHLAFQIYRSFSATLSDL 176 NFHAK+++A+ ELV+GK++A +LQTLL VQ+ VS + LA QI RSFS TLS + Sbjct: 9 NFHAKRKRAISELVEGKKMAARLQTLLQNRVQEDDRSADVSAQELAVQIVRSFSVTLSVV 68 Query: 177 SSCTGPTGSDQIPAVEGG 230 SSC T S QI AV+ G Sbjct: 69 SSC---TESAQIAAVDCG 83 >gb|AAF61863.1|AF193770_1 DNA-binding protein 3 [Nicotiana tabacum] Length = 300 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = +3 Query: 18 KKRKAMVELVKGKEIAIQLQTLLNEPVQDHGPVSPRHLAFQIYRSFSATLSDLSS 182 +K + + ELV GK A QLQTLL +P+ DHGPVS L +I+RSFS +++L++ Sbjct: 11 RKNRVIKELVDGKRFATQLQTLLQQPIADHGPVSADELLLKIWRSFSEAITELNT 65