BLASTX nr result
ID: Mentha29_contig00007127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007127 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus... 101 1e-19 ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citr... 62 6e-08 ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Cit... 58 2e-06 ref|XP_002531125.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus guttatus] Length = 375 Score = 101 bits (251), Expect = 1e-19 Identities = 51/61 (83%), Positives = 55/61 (90%), Gaps = 1/61 (1%) Frame = -1 Query: 189 EDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIP-QKKSGVKES 13 +D FDRLPD+VVLSIF KLQDARSLCLSMAACKRFRSIAPQV IFLP+P QKKS +KES Sbjct: 18 DDSFDRLPDEVVLSIFEKLQDARSLCLSMAACKRFRSIAPQVGEIFLPVPHQKKSAIKES 77 Query: 12 D 10 D Sbjct: 78 D 78 >ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] gi|557548859|gb|ESR59488.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] Length = 389 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/93 (34%), Positives = 56/93 (60%), Gaps = 7/93 (7%) Frame = -1 Query: 258 FDFHSSQTPKSTMDSSSEQILYSE----DFFDRLPDDVVLSIFVKLQDARSLCLSMAACK 91 F++ ++ P ++ E+I+ E D+FD LPD ++L IF KL DA+SL + CK Sbjct: 30 FEYSQAKQPIKRKNNQMERIVLQEEKADDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCK 89 Query: 90 RFRSIAPQVDRIFL---PIPQKKSGVKESDQKN 1 RF S+ PQ++ +FL P P+++ + S +++ Sbjct: 90 RFSSLIPQINNLFLSIIPRPRRQVLIGNSSKRS 122 >ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Citrus sinensis] Length = 345 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/66 (40%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = -1 Query: 189 EDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFL---PIPQKKSGVK 19 +D+FD LPD ++L IF KL DA+SL + CKRF S+ PQ++ +FL P P+++ + Sbjct: 12 DDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCKRFSSLIPQINNLFLSIIPRPRRQVLIG 71 Query: 18 ESDQKN 1 S +++ Sbjct: 72 NSSKRS 77 >ref|XP_002531125.1| conserved hypothetical protein [Ricinus communis] gi|223529289|gb|EEF31259.1| conserved hypothetical protein [Ricinus communis] Length = 356 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -1 Query: 192 SEDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIPQKK 31 +EDFFD LPD ++L IF KL D+RSL + KRF S+ Q D +FL IP K Sbjct: 11 NEDFFDPLPDSLLLLIFNKLCDSRSLAQCLLVSKRFSSLVFQADNVFLSIPTPK 64