BLASTX nr result
ID: Mentha29_contig00007095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007095 (687 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21780.1| hypothetical protein MIMGU_mgv1a011200mg [Mimulus... 58 3e-06 >gb|EYU21780.1| hypothetical protein MIMGU_mgv1a011200mg [Mimulus guttatus] Length = 289 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -1 Query: 162 LDCICYSHLCFCVSLSSSMSTFIPKASASTAVEN*NSQDTDVVATPSVIIDQDS 1 LD + S + SLSSS S FIPKAS++TAVE+ +S +TDV+ TPSV IDQDS Sbjct: 38 LDPVHLSCIVSKKSLSSSTSIFIPKASSATAVEDGSSNETDVIPTPSVTIDQDS 91