BLASTX nr result
ID: Mentha29_contig00007076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007076 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41903.1| hypothetical protein MIMGU_mgv1a012788mg [Mimulus... 64 2e-08 ref|XP_003632581.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 i... 60 2e-07 ref|XP_003632580.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 i... 60 2e-07 ref|XP_003632579.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 i... 60 2e-07 emb|CBI22797.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002265093.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 i... 60 2e-07 gb|EYU26669.1| hypothetical protein MIMGU_mgv1a012816mg [Mimulus... 60 3e-07 ref|XP_004249623.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-l... 60 4e-07 ref|XP_002533379.1| phd/F-box containing protein, putative [Rici... 59 5e-07 ref|XP_006338985.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-l... 57 3e-06 ref|XP_004169326.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-l... 56 5e-06 ref|XP_004149231.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-l... 56 5e-06 ref|XP_004249075.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-l... 56 6e-06 ref|XP_006349453.1| PREDICTED: PHD finger protein ALFIN-LIKE 2-l... 55 8e-06 >gb|EYU41903.1| hypothetical protein MIMGU_mgv1a012788mg [Mimulus guttatus] Length = 240 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MASVSSGPRTVEEIFKD SARRAGIIRALT+DVD Sbjct: 1 MASVSSGPRTVEEIFKDYSARRAGIIRALTFDVD 34 >ref|XP_003632581.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 isoform 4 [Vitis vinifera] Length = 245 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD S RRAG++RALTYDVD Sbjct: 3 MASISSSPRTVEEIFKDYSGRRAGVVRALTYDVD 36 >ref|XP_003632580.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 isoform 3 [Vitis vinifera] Length = 244 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD S RRAG++RALTYDVD Sbjct: 3 MASISSSPRTVEEIFKDYSGRRAGVVRALTYDVD 36 >ref|XP_003632579.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 isoform 2 [Vitis vinifera] Length = 250 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD S RRAG++RALTYDVD Sbjct: 3 MASISSSPRTVEEIFKDYSGRRAGVVRALTYDVD 36 >emb|CBI22797.3| unnamed protein product [Vitis vinifera] Length = 241 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD S RRAG++RALTYDVD Sbjct: 1 MASISSSPRTVEEIFKDYSGRRAGVVRALTYDVD 34 >ref|XP_002265093.1| PREDICTED: PHD finger protein ALFIN-LIKE 1 isoform 1 [Vitis vinifera] Length = 243 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD S RRAG++RALTYDVD Sbjct: 3 MASISSSPRTVEEIFKDYSGRRAGVVRALTYDVD 36 >gb|EYU26669.1| hypothetical protein MIMGU_mgv1a012816mg [Mimulus guttatus] Length = 239 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MASVSS PRTVEEIFKD S+RRAGI+RALT+DVD Sbjct: 1 MASVSSSPRTVEEIFKDFSSRRAGIVRALTFDVD 34 >ref|XP_004249623.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Solanum lycopersicum] Length = 240 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD SARRAGI+RALTYDV+ Sbjct: 1 MASISSTPRTVEEIFKDYSARRAGILRALTYDVE 34 >ref|XP_002533379.1| phd/F-box containing protein, putative [Ricinus communis] gi|223526772|gb|EEF28997.1| phd/F-box containing protein, putative [Ricinus communis] Length = 240 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD +ARR+G++RALTYDVD Sbjct: 1 MASISSSPRTVEEIFKDYNARRSGLVRALTYDVD 34 >ref|XP_006338985.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Solanum tuberosum] Length = 240 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PRTVEEIFKD SARRAGI+RALT DV+ Sbjct: 1 MASISSSPRTVEEIFKDYSARRAGILRALTNDVE 34 >ref|XP_004169326.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Cucumis sativus] Length = 241 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PR+VE+IFKD +ARR G++RALTYDVD Sbjct: 1 MASISSSPRSVEDIFKDYNARRTGLVRALTYDVD 34 >ref|XP_004149231.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Cucumis sativus] Length = 241 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 MAS+SS PR+VE+IFKD +ARR G++RALTYDVD Sbjct: 1 MASISSSPRSVEDIFKDYNARRTGLVRALTYDVD 34 >ref|XP_004249075.1| PREDICTED: PHD finger protein ALFIN-LIKE 1-like [Solanum lycopersicum] Length = 240 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 M+S+SS P+TVEEIFKD S+RR+GI+RALT+DVD Sbjct: 1 MSSISSNPKTVEEIFKDYSSRRSGIVRALTHDVD 34 >ref|XP_006349453.1| PREDICTED: PHD finger protein ALFIN-LIKE 2-like [Solanum tuberosum] Length = 240 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +2 Query: 206 MASVSSGPRTVEEIFKDCSARRAGIIRALTYDVD 307 M+S+SS P+TVEEIFKD S+RR+G++RALT+DVD Sbjct: 1 MSSISSNPKTVEEIFKDYSSRRSGVVRALTHDVD 34