BLASTX nr result
ID: Mentha29_contig00007041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00007041 (837 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18630.1| hypothetical protein MIMGU_mgv1a015164mg [Mimulus... 69 3e-09 gb|EXB38304.1| hypothetical protein L484_013937 [Morus notabilis] 60 1e-06 ref|XP_007028444.1| VQ motif-containing protein, putative [Theob... 59 2e-06 ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808... 57 7e-06 ref|XP_002322621.1| hypothetical protein POPTR_0016s03600g [Popu... 57 9e-06 >gb|EYU18630.1| hypothetical protein MIMGU_mgv1a015164mg [Mimulus guttatus] Length = 166 Score = 68.6 bits (166), Expect = 3e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +1 Query: 253 PLKVVYITNPMKFTATASEFRALVQELTGQDADVSDISRF 372 PLKVVYITNP+K ATASEFRALVQELTGQDAD S+ +RF Sbjct: 35 PLKVVYITNPIKINATASEFRALVQELTGQDADFSETARF 74 >gb|EXB38304.1| hypothetical protein L484_013937 [Morus notabilis] Length = 161 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 253 PLKVVYITNPMKFTATASEFRALVQELTGQDADVSDISRF 372 P+KVVYI+NPMK +ASEFRALVQELTGQDA+ D ++F Sbjct: 30 PVKVVYISNPMKIKTSASEFRALVQELTGQDAEFPDPTKF 69 >ref|XP_007028444.1| VQ motif-containing protein, putative [Theobroma cacao] gi|508717049|gb|EOY08946.1| VQ motif-containing protein, putative [Theobroma cacao] Length = 154 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +1 Query: 253 PLKVVYITNPMKFTATASEFRALVQELTGQDADVSDISRF 372 P+KVVYI+NPMK +AS+FRALVQELTGQDA++ D ++F Sbjct: 28 PIKVVYISNPMKVKTSASKFRALVQELTGQDAELPDPTKF 67 >ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808231 [Glycine max] Length = 168 Score = 57.4 bits (137), Expect = 7e-06 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +1 Query: 253 PLKVVYITNPMKFTATASEFRALVQELTGQDAD-VSDISRF 372 P+KVVYI+NPMK +ASEFRALVQELTGQDA+ D SRF Sbjct: 31 PVKVVYISNPMKIKTSASEFRALVQELTGQDAESPPDPSRF 71 >ref|XP_002322621.1| hypothetical protein POPTR_0016s03600g [Populus trichocarpa] gi|222867251|gb|EEF04382.1| hypothetical protein POPTR_0016s03600g [Populus trichocarpa] Length = 156 Score = 57.0 bits (136), Expect = 9e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 253 PLKVVYITNPMKFTATASEFRALVQELTGQDADVSD 360 P+KVVYI+NPMKF +AS FRALVQELTGQD+++ D Sbjct: 28 PMKVVYISNPMKFKISASGFRALVQELTGQDSELPD 63