BLASTX nr result
ID: Mentha29_contig00006967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00006967 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46600.1| hypothetical protein MIMGU_mgv1a011023mg [Mimulus... 62 8e-08 ref|XP_004136060.1| PREDICTED: uncharacterized isomerase BH0283-... 58 1e-06 ref|XP_003518927.1| PREDICTED: phenazine biosynthesis-like domai... 57 2e-06 gb|ACU23443.1| unknown [Glycine max] 57 2e-06 >gb|EYU46600.1| hypothetical protein MIMGU_mgv1a011023mg [Mimulus guttatus] Length = 294 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +1 Query: 259 QVKLCGHGTLAASHFLFKYDLVRSNNNMIHFFTMSGILKAKRI 387 +VKLCGH TLAASHFLF YDLV+S+ I F T+SGIL AKR+ Sbjct: 80 EVKLCGHATLAASHFLFSYDLVKSDR--IEFLTLSGILTAKRV 120 >ref|XP_004136060.1| PREDICTED: uncharacterized isomerase BH0283-like [Cucumis sativus] gi|449491559|ref|XP_004158936.1| PREDICTED: uncharacterized isomerase BH0283-like [Cucumis sativus] Length = 305 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +1 Query: 259 QVKLCGHGTLAASHFLFKYDLVRSNNNMIHFFTMSGILKAKRIP 390 +++LCGH TLAA+H LF LV N+N+I FFT+SGIL AKR+P Sbjct: 81 EIELCGHATLAAAHILFSTGLV--NSNIIEFFTLSGILTAKRVP 122 >ref|XP_003518927.1| PREDICTED: phenazine biosynthesis-like domain-containing protein-like isoform X1 [Glycine max] gi|571440201|ref|XP_006575078.1| PREDICTED: phenazine biosynthesis-like domain-containing protein-like isoform X2 [Glycine max] Length = 307 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 259 QVKLCGHGTLAASHFLFKYDLVRSNNNMIHFFTMSGILKAKRIP 390 +VKLCGH TLAA+H LF Y LV N N+I FFT SG+L K+IP Sbjct: 85 EVKLCGHATLAAAHTLFSYGLV--NFNIIEFFTASGVLTTKKIP 126 >gb|ACU23443.1| unknown [Glycine max] Length = 206 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 259 QVKLCGHGTLAASHFLFKYDLVRSNNNMIHFFTMSGILKAKRIP 390 +VKLCGH TLAA+H LF Y LV N N+I FFT SG+L K+IP Sbjct: 85 EVKLCGHATLAAAHTLFSYGLV--NFNIIEFFTASGVLTTKKIP 126