BLASTX nr result
ID: Mentha29_contig00005742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00005742 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73399.1| precursor of protein cell division protease ftsh-... 68 1e-09 gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Mimulus... 67 3e-09 gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Mimulus... 67 3e-09 gb|EYU17514.1| hypothetical protein MIMGU_mgv1a004291mg [Mimulus... 58 2e-06 >gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, partial [Genlisea aurea] Length = 694 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = +3 Query: 225 LTNPLLSSNFLGSQIFISAPTPKTVPRRFIVPKSILDENKSNKSRRSEEHTS 380 LTNP +SS+FLGSQ+FIS PTPKT+PR+ VP+SILD SN+S+ + H + Sbjct: 1 LTNPSISSSFLGSQLFISPPTPKTLPRKLFVPQSILDGKCSNRSKCIQNHAA 52 >gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Mimulus guttatus] Length = 705 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = +3 Query: 225 LTNPLLSSNFLGSQIFISAPTPKTVPRRF-IVPKSILDENKSNKSRRS 365 LTNPLLSS F G+QIFIS PTPKTVP+RF VPKS+L+ SNKS+ + Sbjct: 5 LTNPLLSSKFFGTQIFISPPTPKTVPKRFAAVPKSLLNHKNSNKSQNA 52 >gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Mimulus guttatus] Length = 656 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = +3 Query: 225 LTNPLLSSNFLGSQIFISAPTPKTVPRRF-IVPKSILDENKSNKSRRS 365 LTNPLLSS F G+QIFIS PTPKTVP+RF VPKS+L+ SNKS+ + Sbjct: 5 LTNPLLSSKFFGTQIFISPPTPKTVPKRFAAVPKSLLNHKNSNKSQNA 52 >gb|EYU17514.1| hypothetical protein MIMGU_mgv1a004291mg [Mimulus guttatus] Length = 534 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/52 (59%), Positives = 39/52 (75%), Gaps = 6/52 (11%) Frame = +3 Query: 228 TNPLLSSNFLGSQIFISAPTPK--TVPRRFIVPKSILD----ENKSNKSRRS 365 T PLLSSNF G+QIFIS PTPK T+PRRF++P+SIL+ +KS KS + Sbjct: 8 TKPLLSSNFFGAQIFISPPTPKTTTLPRRFLLPQSILNRRIISDKSTKSNNN 59