BLASTX nr result
ID: Mentha29_contig00005255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00005255 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26673.1| hypothetical protein MIMGU_mgv1a007867mg [Mimulus... 69 7e-10 >gb|EYU26673.1| hypothetical protein MIMGU_mgv1a007867mg [Mimulus guttatus] Length = 393 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = -2 Query: 362 EEICMLTEESVSENWIYGMELKFGNFEEICQEFGQEILELLLNQLVDEFV 213 EEIC L +E V+ENW+ G +L+F +FE++CQ FGQEIL++LL Q VDE V Sbjct: 335 EEICRLADEDVNENWMDGCKLEFEDFEDMCQHFGQEILQVLLQQFVDELV 384