BLASTX nr result
ID: Mentha29_contig00004223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00004223 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33869.1| hypothetical protein MIMGU_mgv1a010099mg [Mimulus... 60 4e-07 >gb|EYU33869.1| hypothetical protein MIMGU_mgv1a010099mg [Mimulus guttatus] Length = 322 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/72 (50%), Positives = 48/72 (66%), Gaps = 8/72 (11%) Frame = +2 Query: 29 MSSTSTNMASTVSVNQFPCKLL----QSSKLIPNNAFSPVNRLNFPALST----KLKQNF 184 ++STS MAS S+++ PC L Q+SK P A VNR+ FPALST K+K++F Sbjct: 4 IASTSAKMASIASISKLPCNSLKNSSQNSKSAPIVASCSVNRVKFPALSTANSAKVKRDF 63 Query: 185 SVKAVVSDDEWG 220 SV+ +VSDDEWG Sbjct: 64 SVR-LVSDDEWG 74