BLASTX nr result
ID: Mentha29_contig00003942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003942 (935 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992313.1| ribosomal protein S4 (mitochondrion) [Salvia... 77 1e-11 ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. m... 75 3e-11 dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [N... 75 3e-11 ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 75 4e-11 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 75 4e-11 ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica ... 75 5e-11 ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|375911... 74 8e-11 sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitoc... 74 8e-11 gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] 74 8e-11 ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclep... 74 1e-10 ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgari... 74 1e-10 ref|YP_006460178.1| ribosomal protein subunit S4 (mitochondrion)... 72 2e-10 gb|EPS74675.1| hypothetical protein M569_00050 [Genlisea aurea] 72 3e-10 ref|YP_005090421.1| rps4 gene product (mitochondrion) [Boea hygr... 71 7e-10 gb|AGL75402.1| ribosomal protein S4 (mitochondrion) [Utricularia... 70 1e-09 gb|EXB57808.1| hypothetical protein L484_002790 [Morus notabilis] 69 3e-09 gb|AHA47128.1| ribosomal protein S4 (mitochondrion) [Amborella t... 69 3e-09 ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|... 69 3e-09 ref|YP_007889804.1| ribosomal protein S4 (mitochondrion) [Vigna ... 67 8e-09 ref|YP_007516900.1| ribosomal protein S4 (mitochondrion) [Glycin... 67 8e-09 >ref|YP_008992313.1| ribosomal protein S4 (mitochondrion) [Salvia miltiorrhiza] gi|534292286|gb|AGU16578.1| ribosomal protein S4 (mitochondrion) [Salvia miltiorrhiza] Length = 351 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/67 (55%), Positives = 47/67 (70%) Frame = -2 Query: 589 SYSPQQLGTNRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLL 410 S SP Q NR +N+KIK+I+LPTHY EVNH+ KA++ YGP+I HIP + +KD NLL Sbjct: 281 SASPHQFTMNRKRKNRKIKRIELPTHYSEVNHRTPKAVVSYGPNIGHIPHDIRLKDPNLL 340 Query: 409 CWSEYER 389 S ER Sbjct: 341 LRSGNER 347 >ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|317905723|emb|CBJ14108.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|319439803|emb|CBJ17515.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] Length = 315 Score = 75.5 bits (184), Expect = 3e-11 Identities = 35/71 (49%), Positives = 51/71 (71%) Frame = -2 Query: 613 ANVDRMRKSYSPQQLGTNRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHV 434 A +RM++++S T + ++IK+I+LPTHY EVNH+ KA++FYGP+I HIP + Sbjct: 239 AEHNRMKRNFSHSV--TLFLSKKRRIKRIELPTHYSEVNHRTLKAVVFYGPNIDHIPHDI 296 Query: 433 SMKDLNLLCWS 401 +KDLNLL WS Sbjct: 297 RLKDLNLLLWS 307 >dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [Nicotiana tabacum] Length = 349 Score = 75.5 bits (184), Expect = 3e-11 Identities = 32/54 (59%), Positives = 44/54 (81%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 401 ++F + KIK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 288 HQFTKKIKIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 341 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gi|357197350|gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 75.1 bits (183), Expect = 4e-11 Identities = 31/54 (57%), Positives = 44/54 (81%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 401 ++F ++IK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 297 HQFTMKRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 350 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|372450274|ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197313|gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197320|gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 75.1 bits (183), Expect = 4e-11 Identities = 31/54 (57%), Positives = 44/54 (81%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 401 ++F ++IK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 297 HQFTMKRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 350 >ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica Group] gi|92700092|dbj|BAC19883.2| Ribosomal protein S4 [Oryza sativa Japonica Group] Length = 352 Score = 74.7 bits (182), Expect = 5e-11 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = -2 Query: 556 FGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 401 F R +IK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 293 FTRKIRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 344 >ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|37591124|dbj|BAC98926.1| ribosomal protein S4 [Brassica napus] Length = 362 Score = 73.9 bits (180), Expect = 8e-11 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = -2 Query: 544 KKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 389 ++IK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS R Sbjct: 307 RRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitochondrial Length = 362 Score = 73.9 bits (180), Expect = 8e-11 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = -2 Query: 544 KKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 389 ++IK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS R Sbjct: 307 RRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] Length = 362 Score = 73.9 bits (180), Expect = 8e-11 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = -2 Query: 544 KKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 389 ++IK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS R Sbjct: 307 RRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] gi|556562347|gb|AGZ63043.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] Length = 274 Score = 73.6 bits (179), Expect = 1e-10 Identities = 31/54 (57%), Positives = 43/54 (79%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 401 ++F +K K+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 213 HQFTMKRKRKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 266 >ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|346683270|ref|YP_004842202.1| ribosomal protein S4 [Beta macrocarpa] gi|87248052|gb|ABD36080.1| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|148491424|dbj|BAA99356.2| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|320148708|emb|CBJ23346.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|345500188|emb|CBX25007.1| ribosomal protein S4 [Beta macrocarpa] gi|384939188|emb|CBL52035.1| ribosoma lprotein S4 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 315 Score = 73.6 bits (179), Expect = 1e-10 Identities = 33/74 (44%), Positives = 49/74 (66%) Frame = -2 Query: 622 RVGANVDRMRKSYSPQQLGTNRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIP 443 + G++ + R + T + ++IK+I+LPTHY EVNH+ KA++FYGP+I HIP Sbjct: 234 KFGSDAEHNRMKRNFYHSVTLFLSKKRRIKRIELPTHYSEVNHRTLKAVVFYGPNIDHIP 293 Query: 442 LHVSMKDLNLLCWS 401 + +KDLNLL WS Sbjct: 294 HDIRLKDLNLLLWS 307 >ref|YP_006460178.1| ribosomal protein subunit S4 (mitochondrion) [Mimulus guttatus] gi|340007672|gb|AEK26536.1| ribosomal protein subunit S4 (mitochondrion) [Mimulus guttatus] Length = 353 Score = 72.4 bits (176), Expect = 2e-10 Identities = 35/67 (52%), Positives = 45/67 (67%) Frame = -2 Query: 589 SYSPQQLGTNRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLL 410 S SP Q R + +KIK+I+LPTHY EVNH+ KA++ YGP+I HIP + +KD NLL Sbjct: 283 SASPHQFTMKRKRKKRKIKRIELPTHYSEVNHRTPKAVVSYGPNIGHIPHDIRLKDPNLL 342 Query: 409 CWSEYER 389 S ER Sbjct: 343 LRSGNER 349 >gb|EPS74675.1| hypothetical protein M569_00050 [Genlisea aurea] Length = 354 Score = 72.0 bits (175), Expect = 3e-10 Identities = 36/67 (53%), Positives = 46/67 (68%) Frame = -2 Query: 589 SYSPQQLGTNRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLL 410 S SP Q R +KIK+I+LPTHYLEVNH+ +KA++ YGP+I HIP + +KD NLL Sbjct: 287 SASPHQFTMKR---KRKIKRIELPTHYLEVNHRTQKAVVSYGPNIGHIPHDIRLKDPNLL 343 Query: 409 CWSEYER 389 S ER Sbjct: 344 LRSRNER 350 >ref|YP_005090421.1| rps4 gene product (mitochondrion) [Boea hygrometrica] gi|340549497|gb|AEK53318.1| ribosomal protein S4 (mitochondrion) [Boea hygrometrica] Length = 329 Score = 70.9 bits (172), Expect = 7e-10 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 389 ++F +KIK+I+LPTHY EVNH+ KA++FYGP+I HIP + +KD NLL S ER Sbjct: 268 HQFTMKRKIKRIELPTHYSEVNHRTPKAVVFYGPNIGHIPHDIRLKDPNLLLRSGNER 325 >gb|AGL75402.1| ribosomal protein S4 (mitochondrion) [Utricularia gibba] Length = 370 Score = 70.1 bits (170), Expect = 1e-09 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEYER 389 ++F +KIK+I+LPTHYLEVNH+ KA++ YGP+I HIP + +KD NLL S ER Sbjct: 305 HQFTMKRKIKRIELPTHYLEVNHRTPKAVISYGPNIGHIPHDIRLKDPNLLLRSGNER 362 >gb|EXB57808.1| hypothetical protein L484_002790 [Morus notabilis] Length = 263 Score = 68.6 bits (166), Expect = 3e-09 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLL 410 ++F ++IK+I+LPTHYLEVNH+ KA++ YGP+I HIP + +KDLNLL Sbjct: 202 HQFTMKRRIKRIELPTHYLEVNHRTPKAMVSYGPNIGHIPHDIRLKDLNLL 252 >gb|AHA47128.1| ribosomal protein S4 (mitochondrion) [Amborella trichopoda] Length = 354 Score = 68.6 bits (166), Expect = 3e-09 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNL 413 +RF R ++IK+I+LPTHYLEVN++ KA++FYGP I HIP + +KD NL Sbjct: 284 HRFTRKRRIKRIELPTHYLEVNYRTLKAVVFYGPDIGHIPHDIRLKDPNL 333 >ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|259156791|gb|ACV96653.1| ribosomal protein S4 [Citrullus lanatus] Length = 355 Score = 68.6 bits (166), Expect = 3e-09 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -2 Query: 562 NRFGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNL 413 ++F KIK+I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNL Sbjct: 294 HQFTMKSKIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNL 343 >ref|YP_007889804.1| ribosomal protein S4 (mitochondrion) [Vigna angularis] gi|478620963|dbj|BAN15009.1| ribosomal protein S4 (mitochondrion) [Vigna angularis] Length = 346 Score = 67.4 bits (163), Expect = 8e-09 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 556 FGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNL 413 F R ++IK+I+LPTHY EVNH+ KA++FYGP+I HIP + +KD NL Sbjct: 287 FPRKRRIKRIELPTHYSEVNHRTPKAVVFYGPNIGHIPHDIRLKDPNL 334 >ref|YP_007516900.1| ribosomal protein S4 (mitochondrion) [Glycine max] gi|403311571|gb|AFR34319.1| ribosomal protein S4 (mitochondrion) [Glycine max] Length = 346 Score = 67.4 bits (163), Expect = 8e-09 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 556 FGRNKKIKKIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNL 413 F R ++IK+I+LPTHY EVNH+ KA++FYGP+I HIP + +KD NL Sbjct: 287 FPRKRRIKRIELPTHYSEVNHRTPKAVVFYGPNIGHIPHDIRLKDPNL 334