BLASTX nr result
ID: Mentha29_contig00003904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003904 (618 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29731.1| hypothetical protein MIMGU_mgv1a012759mg [Mimulus... 62 1e-07 >gb|EYU29731.1| hypothetical protein MIMGU_mgv1a012759mg [Mimulus guttatus] Length = 241 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +2 Query: 2 SSSEYNTLWESKFQPFIRKALHVHFSVDPVGKKLM 106 SSSEYNT+W+SKF+P ++KAL +HFSVDPVGK+LM Sbjct: 207 SSSEYNTIWKSKFEPIVQKALSLHFSVDPVGKELM 241