BLASTX nr result
ID: Mentha29_contig00003757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003757 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33565.1| hypothetical protein MIMGU_mgv1a001603mg [Mimulus... 59 7e-07 gb|EPS66226.1| ubiquitin carboxyl-terminal hydrolase, partial [G... 57 2e-06 >gb|EYU33565.1| hypothetical protein MIMGU_mgv1a001603mg [Mimulus guttatus] Length = 786 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 42 VISYAEDESVVDPLLAQHLQHFGIDFSSLKK 134 V SY EDESVVDPLLAQHLQHFGIDFSSL+K Sbjct: 241 VYSYDEDESVVDPLLAQHLQHFGIDFSSLQK 271 >gb|EPS66226.1| ubiquitin carboxyl-terminal hydrolase, partial [Genlisea aurea] Length = 271 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 42 VISYAEDESVVDPLLAQHLQHFGIDFSSLKK 134 V SY EDE+V+DPLLAQHLQHFGIDFSSL+K Sbjct: 241 VFSYEEDEAVLDPLLAQHLQHFGIDFSSLQK 271