BLASTX nr result
ID: Mentha29_contig00003709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003709 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37456.1| hypothetical protein MIMGU_mgv1a008276mg [Mimulus... 66 6e-09 ref|XP_006363873.1| PREDICTED: carbon catabolite repressor prote... 58 2e-06 ref|XP_006363872.1| PREDICTED: carbon catabolite repressor prote... 58 2e-06 ref|XP_004246039.1| PREDICTED: carbon catabolite repressor prote... 57 2e-06 >gb|EYU37456.1| hypothetical protein MIMGU_mgv1a008276mg [Mimulus guttatus] Length = 379 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 LPETESLDVSGGLPNYFHPSDHVPIGTEFEVEA 101 LPE ES DVSGGLPNYFHPSDH+PIG EFEVEA Sbjct: 347 LPEAESSDVSGGLPNYFHPSDHLPIGAEFEVEA 379 >ref|XP_006363873.1| PREDICTED: carbon catabolite repressor protein 4 homolog 4-like isoform X2 [Solanum tuberosum] gi|565396553|ref|XP_006363874.1| PREDICTED: carbon catabolite repressor protein 4 homolog 4-like isoform X3 [Solanum tuberosum] Length = 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 LPETESLDVSGGLPNYFHPSDHVPIGTEFEV 95 LPE E+ DV GGLPNY+HPSDH+PIG EFE+ Sbjct: 332 LPEPEASDVQGGLPNYYHPSDHLPIGAEFEI 362 >ref|XP_006363872.1| PREDICTED: carbon catabolite repressor protein 4 homolog 4-like isoform X1 [Solanum tuberosum] Length = 390 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 LPETESLDVSGGLPNYFHPSDHVPIGTEFEV 95 LPE E+ DV GGLPNY+HPSDH+PIG EFE+ Sbjct: 358 LPEPEASDVQGGLPNYYHPSDHLPIGAEFEI 388 >ref|XP_004246039.1| PREDICTED: carbon catabolite repressor protein 4 homolog 4-like [Solanum lycopersicum] Length = 389 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +3 Query: 3 LPETESLDVSGGLPNYFHPSDHVPIGTEFEV 95 LPE E+ D+ GGLPNY+HPSDH+PIG EFE+ Sbjct: 357 LPEPEASDIQGGLPNYYHPSDHLPIGAEFEI 387