BLASTX nr result
ID: Mentha29_contig00003632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00003632 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32222.1| hypothetical protein MIMGU_mgv1a010015mg [Mimulus... 75 1e-11 gb|AGQ04247.1| WRKY transcription factor 53 [Jatropha curcas] 56 6e-06 >gb|EYU32222.1| hypothetical protein MIMGU_mgv1a010015mg [Mimulus guttatus] Length = 324 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/59 (61%), Positives = 48/59 (81%) Frame = +1 Query: 34 MEKVGVSEKKTVITVLTEGRKLANQLKRELHPTTTSREACEVLLENILSSYENAITLLD 210 M +G ++ TV++VLTEGR+ AN+LK +LHP +S EAC+VLLE+ILSSYENA+ LLD Sbjct: 1 MGAIGSWDRTTVVSVLTEGRERANELKNQLHPAISSIEACDVLLESILSSYENALHLLD 59 >gb|AGQ04247.1| WRKY transcription factor 53 [Jatropha curcas] Length = 357 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/60 (46%), Positives = 45/60 (75%) Frame = +1 Query: 34 MEKVGVSEKKTVITVLTEGRKLANQLKRELHPTTTSREACEVLLENILSSYENAITLLDL 213 ME +G E+K ++ LT GR+LA QL+ L+ ++SREA E+L++ IL+SYE A+++L+L Sbjct: 1 MENMGDWEQKNLVNELTTGRELARQLQVHLNIPSSSREAREMLVQRILNSYEKALSILNL 60