BLASTX nr result
ID: Mentha29_contig00001452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00001452 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41959.1| hypothetical protein MIMGU_mgv1a011092mg [Mimulus... 57 3e-06 >gb|EYU41959.1| hypothetical protein MIMGU_mgv1a011092mg [Mimulus guttatus] Length = 292 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/83 (40%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +2 Query: 2 PTTTVPTSLLVATITXXXXXXXXXXXXXXXXXXXXXXX-GWFSARRKTPLRPXXXXXXXX 178 P+TT TSLL+ATIT GWFSARR+TPLRP Sbjct: 50 PSTTAATSLLIATITSFISLPSHLPLPPPPPATNSTALVGWFSARRRTPLRPSLKDSTTS 109 Query: 179 XXXXXXXXXXFTPQNSTLSLPPS 247 FTPQNST++LPPS Sbjct: 110 ISLSSSPTLAFTPQNSTITLPPS 132