BLASTX nr result
ID: Mentha29_contig00001167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00001167 (533 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46441.1| hypothetical protein MIMGU_mgv1a0022921mg, partia... 60 4e-07 >gb|EYU46441.1| hypothetical protein MIMGU_mgv1a0022921mg, partial [Mimulus guttatus] gi|604348287|gb|EYU46442.1| hypothetical protein MIMGU_mgv1a0022921mg, partial [Mimulus guttatus] Length = 463 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 533 AILFHLGIAAVLGLYALFWFKLDLFTTLKS 444 AILFHLGIAAVL LYALFWFKLDLFTTLK+ Sbjct: 405 AILFHLGIAAVLSLYALFWFKLDLFTTLKT 434