BLASTX nr result
ID: Mentha29_contig00000144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00000144 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20831.1| hypothetical protein MIMGU_mgv1a000252mg [Mimulus... 66 6e-09 >gb|EYU20831.1| hypothetical protein MIMGU_mgv1a000252mg [Mimulus guttatus] Length = 1359 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/71 (42%), Positives = 46/71 (64%) Frame = +3 Query: 3 LVDMHYFVPSHYDHVFHQMKYKIGDEMTIFLQTQPLKPKFGKYLDCKMSYAAEVEHMSVT 182 L+++ + VPS Y H ++KYK+G MT+FLQ Q L+PKF L+ K +VE++S+ Sbjct: 909 LLNLDFIVPSGYCHFADEVKYKVGHNMTMFLQNQLLEPKFQNNLEGKQRRMVKVENLSLA 968 Query: 183 FKNIDHMELGV 215 FK IDH+ + Sbjct: 969 FKEIDHINFRI 979