BLASTX nr result
ID: Mentha28_contig00037471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00037471 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08700.1| Endonuclease/exonuclease/phosphatase [Medicago tr... 74 3e-11 ref|XP_003604531.1| hypothetical protein MTR_4g014190 [Medicago ... 59 9e-07 >gb|ABN08700.1| Endonuclease/exonuclease/phosphatase [Medicago truncatula] Length = 814 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -2 Query: 144 GQGPFPLPCTMRIILWNVRGCNKPFKQKDIKIFLQKNKADIAILLETR 1 G+GP+PL M+++ WNVRGCNKPFKQK+IK FL KNK D+ IL+ETR Sbjct: 508 GRGPYPLWFDMKLVCWNVRGCNKPFKQKEIKNFLLKNKFDMCILVETR 555 >ref|XP_003604531.1| hypothetical protein MTR_4g014190 [Medicago truncatula] gi|355505586|gb|AES86728.1| hypothetical protein MTR_4g014190 [Medicago truncatula] Length = 382 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/105 (32%), Positives = 50/105 (47%), Gaps = 6/105 (5%) Frame = -3 Query: 473 LLYKVQIEGEQGKMIDQQVFYEWVPMFC*HCHKVGHICKKISEGRGESVSEEAMASEG*R 294 LLYKV +E GK +Q++ Y+W P FC C +VGH+C K S E ++ + Sbjct: 273 LLYKVMVESPDGKCFEQRIVYDWEPSFCKKCQQVGHVCDKQSFQPVERPKKDWIPKTQVN 332 Query: 293 KASGGRGCSPDR----GIWIKPKKVATP--TIQVGNLQVPTGNGY 177 G+ P++ W P+K AT + + VPT N Y Sbjct: 333 LVDKGK--QPEKINSDIEWNVPRKTATKQHVVSQNSTMVPTSNSY 375