BLASTX nr result
ID: Mentha28_contig00037458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00037458 (541 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29225.1| hypothetical protein MIMGU_mgv1a022163mg, partial... 103 3e-20 >gb|EYU29225.1| hypothetical protein MIMGU_mgv1a022163mg, partial [Mimulus guttatus] Length = 907 Score = 103 bits (257), Expect = 3e-20 Identities = 61/124 (49%), Positives = 79/124 (63%), Gaps = 8/124 (6%) Frame = +2 Query: 194 QNENSIKAAAALSTEPVLKEAGKSPEALLH----RRSLQLEDTSY-TVVSLPAQSPSNSG 358 +NE+ ++A A TEP LK+ PE H RR LQ +D+ Y +++ A+ PSN Sbjct: 240 RNESFVEANGAALTEPFLKKVQNDPEVFQHGGTRRRCLQFQDSQYKAILNQSAEIPSNCD 299 Query: 359 GLIS-PLETPCTPIKGKETEKVQ-PSYPQN-RNNTANIPKPSGIGLHLNSIINVLQTGSG 529 G+ S LETP PI GK E Q YP+N N+T NIPKPSGIGLHLNSI+N +Q GSG Sbjct: 300 GIKSLSLETPSMPINGKHDEVTQLVRYPKNYSNSTINIPKPSGIGLHLNSIVNTVQPGSG 359 Query: 530 AVVH 541 A+V+ Sbjct: 360 AIVN 363