BLASTX nr result
ID: Mentha28_contig00037454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00037454 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006378909.1| hypothetical protein POPTR_0009s00490g, part... 56 5e-06 >ref|XP_006378909.1| hypothetical protein POPTR_0009s00490g, partial [Populus trichocarpa] gi|550330732|gb|ERP56706.1| hypothetical protein POPTR_0009s00490g, partial [Populus trichocarpa] Length = 443 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -1 Query: 366 LTYVRICVEVDLTTPIPHEIFLNI-DGVVLSQKIVFEKLPGYCLGCKHVGHSVGNC 202 L+Y RI VEVDL +PH + + + +G +LSQ++ +E LP +C C+ +GHS +C Sbjct: 227 LSYARILVEVDLLQELPHAVQVVLPNGTLLSQQVTYESLPRFCTRCRVIGHSANSC 282