BLASTX nr result
ID: Mentha28_contig00036924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00036924 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63299.1| obtusifoliol-14-demethylase [Genlisea aurea] 46 1e-06 gb|EYU28484.1| hypothetical protein MIMGU_mgv1a005246mg [Mimulus... 45 3e-06 gb|AAL40888.1| obtusifoliol-14-demethylase [Nicotiana tabacum] 48 3e-06 >gb|EPS63299.1| obtusifoliol-14-demethylase [Genlisea aurea] Length = 496 Score = 45.8 bits (107), Expect(3) = 1e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -1 Query: 286 SIRQEQFRFFTEVLRV---KGYVDHMVMQWELRYF 191 S+RQEQFRFFTE LRV KGYVD MVM+ E YF Sbjct: 131 SVRQEQFRFFTEALRVTKLKGYVDQMVMETE-EYF 164 Score = 27.7 bits (60), Expect(3) = 1e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 113 LLGEEVRNNLFE 78 LLGEEVRNNLFE Sbjct: 191 LLGEEVRNNLFE 202 Score = 23.5 bits (49), Expect(3) = 1e-06 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 339 ESDRRQQEVYQLDVEYSDP 283 ESD QQEVYQ +V P Sbjct: 104 ESDLSQQEVYQFNVPTFGP 122 >gb|EYU28484.1| hypothetical protein MIMGU_mgv1a005246mg [Mimulus guttatus] gi|604315920|gb|EYU28485.1| hypothetical protein MIMGU_mgv1a005246mg [Mimulus guttatus] Length = 492 Score = 44.7 bits (104), Expect(3) = 3e-06 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -1 Query: 286 SIRQEQFRFFTEVLRV---KGYVDHMVMQWELRYF 191 +IRQEQFRFFTE LRV KGYVD MVM+ E YF Sbjct: 130 TIRQEQFRFFTEALRVNKLKGYVDQMVMEAE-EYF 163 Score = 27.7 bits (60), Expect(3) = 3e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 113 LLGEEVRNNLFE 78 LLGEEVRNNLFE Sbjct: 190 LLGEEVRNNLFE 201 Score = 23.5 bits (49), Expect(3) = 3e-06 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 339 ESDRRQQEVYQLDVEYSDP 283 ESD QQEVYQ +V P Sbjct: 103 ESDLSQQEVYQFNVPTFGP 121 >gb|AAL40888.1| obtusifoliol-14-demethylase [Nicotiana tabacum] Length = 487 Score = 47.8 bits (112), Expect(3) = 3e-06 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 3/35 (8%) Frame = -1 Query: 286 SIRQEQFRFFTEVLRV---KGYVDHMVMQWELRYF 191 +IRQEQFRFFTE LRV KGYVDHMVM+ E YF Sbjct: 125 TIRQEQFRFFTEALRVNKLKGYVDHMVMEAE-EYF 158 Score = 25.4 bits (54), Expect(3) = 3e-06 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 113 LLGEEVRNNLFE 78 LLGEEVRN LFE Sbjct: 185 LLGEEVRNKLFE 196 Score = 22.3 bits (46), Expect(3) = 3e-06 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 339 ESDRRQQEVYQLDVEYSDP 283 E+D QQEVYQ +V P Sbjct: 98 ETDLSQQEVYQFNVPTFGP 116