BLASTX nr result
ID: Mentha28_contig00036901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00036901 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322214.2| speckle-type POZ family protein [Populus tri... 51 8e-07 ref|XP_006376888.1| hypothetical protein POPTR_0012s09300g [Popu... 50 3e-06 ref|XP_006387987.1| speckle-type POZ family protein [Populus tri... 50 3e-06 ref|XP_007037818.1| BTB and TAZ domain protein 2 isoform 1 [Theo... 54 4e-06 ref|XP_007037819.1| BTB and TAZ domain protein 2 isoform 2 [Theo... 54 4e-06 ref|XP_007037820.1| BTB and TAZ domain protein 2 isoform 3, part... 54 4e-06 >ref|XP_002322214.2| speckle-type POZ family protein [Populus trichocarpa] gi|550322402|gb|EEF06341.2| speckle-type POZ family protein [Populus trichocarpa] Length = 360 Score = 51.2 bits (121), Expect(2) = 8e-07 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = -1 Query: 254 MHPCISSFHDECRVPLCRKFKSKELQDRSESNELWRLLVRKVALAKAILS 105 +H I D CRVPLCR+FK K ++ LWRLLV+KVA A+A+ S Sbjct: 286 LHSSICDQTDSCRVPLCRQFKLKMQLEKKGVETLWRLLVKKVASARAMSS 335 Score = 27.3 bits (59), Expect(2) = 8e-07 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 109 SLPKRKREESRTVVNYQK*RSFKL 38 SLPKRKREE R ++ R+F+L Sbjct: 337 SLPKRKREEPRETMHDHGIRNFRL 360 >ref|XP_006376888.1| hypothetical protein POPTR_0012s09300g [Populus trichocarpa] gi|550326732|gb|ERP54685.1| hypothetical protein POPTR_0012s09300g [Populus trichocarpa] Length = 364 Score = 50.1 bits (118), Expect(2) = 3e-06 Identities = 24/50 (48%), Positives = 31/50 (62%) Frame = -1 Query: 254 MHPCISSFHDECRVPLCRKFKSKELQDRSESNELWRLLVRKVALAKAILS 105 +H I D CRVPLCR+FK K ++R LW LLV+KVA A+ + S Sbjct: 290 LHSSICDQTDSCRVPLCRQFKLKMQRERRGDETLWSLLVKKVASARVMSS 339 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 109 SLPKRKREESRTVVNYQK*RSFK 41 SLPKRKREE R ++ R+F+ Sbjct: 341 SLPKRKREEPRETIHDHGIRNFR 363 >ref|XP_006387987.1| speckle-type POZ family protein [Populus trichocarpa] gi|550309139|gb|ERP46901.1| speckle-type POZ family protein [Populus trichocarpa] Length = 364 Score = 50.1 bits (118), Expect(2) = 3e-06 Identities = 24/50 (48%), Positives = 31/50 (62%) Frame = -1 Query: 254 MHPCISSFHDECRVPLCRKFKSKELQDRSESNELWRLLVRKVALAKAILS 105 +H I D CRVPLCR+FK K ++R LW LLV+KVA A+ + S Sbjct: 290 LHSSICDQTDSCRVPLCRQFKLKMQRERRGDETLWSLLVKKVASARVMSS 339 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 109 SLPKRKREESRTVVNYQK*RSFK 41 SLPKRKREE R ++ R+F+ Sbjct: 341 SLPKRKREEPRETIHDHGIRNFR 363 >ref|XP_007037818.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] gi|508775063|gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 54.3 bits (129), Expect(2) = 4e-06 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -1 Query: 254 MHPCISSFHDECRVPLCRKFKSKELQDRSESNELWRLLVRKVALAKAILS 105 +H I D CRVPLCR+FK K Q R + LW+LLVRKV AK I S Sbjct: 278 LHSSICDQPDSCRVPLCRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISS 327 Score = 21.9 bits (45), Expect(2) = 4e-06 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 109 SLPKRKREE 83 SLPKRKREE Sbjct: 329 SLPKRKREE 337 >ref|XP_007037819.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] gi|508775064|gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] Length = 334 Score = 54.3 bits (129), Expect(2) = 4e-06 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -1 Query: 254 MHPCISSFHDECRVPLCRKFKSKELQDRSESNELWRLLVRKVALAKAILS 105 +H I D CRVPLCR+FK K Q R + LW+LLVRKV AK I S Sbjct: 258 LHSSICDQPDSCRVPLCRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISS 307 Score = 21.9 bits (45), Expect(2) = 4e-06 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 109 SLPKRKREE 83 SLPKRKREE Sbjct: 309 SLPKRKREE 317 >ref|XP_007037820.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] gi|508775065|gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 54.3 bits (129), Expect(2) = 4e-06 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = -1 Query: 254 MHPCISSFHDECRVPLCRKFKSKELQDRSESNELWRLLVRKVALAKAILS 105 +H I D CRVPLCR+FK K Q R + LW+LLVRKV AK I S Sbjct: 177 LHSSICDQPDSCRVPLCRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISS 226 Score = 21.9 bits (45), Expect(2) = 4e-06 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 109 SLPKRKREE 83 SLPKRKREE Sbjct: 228 SLPKRKREE 236