BLASTX nr result
ID: Mentha28_contig00036479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00036479 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69708.1| hypothetical protein M569_05061, partial [Genlise... 53 9e-08 >gb|EPS69708.1| hypothetical protein M569_05061, partial [Genlisea aurea] Length = 71 Score = 52.8 bits (125), Expect(2) = 9e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 241 LHK*KESEFDKLNHDQEVKFLNYVAAADEMIE 336 L + KESEFDKLNH QEVKFLNY AADEMI+ Sbjct: 15 LKREKESEFDKLNHAQEVKFLNYATAADEMIQ 46 Score = 29.3 bits (64), Expect(2) = 9e-08 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +2 Query: 110 MEDLYSKLYNKYTTL 154 ME LY+KLYNKYT L Sbjct: 1 MESLYAKLYNKYTKL 15